El blog del Dr. Enrique Rubio

Categoría: TUMORES (Página 1 de 9)

SIDA Y CIRUGIA

40 AÑOS DE SIDA: EL PRIMER CASO DE VIH DEL ESTADO SE DIAGNOSTICÓ EN VALL D’HEBRON

DRES ENRIQUE RUBIO Y ALEJANDRO GUTIERREZ NEUROCIRUJANOS 40 años de sida: el primer caso de VIH del Estado se diagnosticó en Vall d’Hebron

No hace mucho tiempo en el Colegio de Médicos de Barcelona la doctora “Español Médico del Valle de Hebrón” dio una conferencia a la que yo asistí. Sobre el primer caso de SIDA y no mencionó a los Neurocirujanos que habían intervenido al paciente

Al terminar tu charla la interpele y le pregunté quién había sido el cirujano que operó a este paciente y ella no lo sabía , entonces le dije doctora pues soy yo que con el Dr. Alejandro Gutierrez, fui requerido para operar un tumor frontal en un paciente , con mucha patologia

Fui requerido por el Servicio de Medicina interna, para operar a este paciente descrito mas abajo.

Y efectivamente tenía un tumor frontal derecho y un llamativo Sarcoma de Kaposi en el tórax.

Desde el principio me llamo la atención que me pidieran que la operación iba a ser en un quirófano, diferente al neuroquirúrgico, “sin razones.” Todo ello con mucho misterio, al que yo eludí por la gravedad del paciente.

Por supuesto me sorprendió tanto misterio, pero aquello no iba de discusiones, o se operaba o se Moria y decidimos Alejandro y yo operarlo.

No sabíamos nada de SIDA, aun no se había difundido la epidemia, solo los Internistas y Patólogos sabían del tema.

Operar al paciente era imperativo, porque sin la extirpación del tumor, no hay diagnostico.

El paciente con un parasito inusual en el cerebro, murió en poco tiempo y nada mas. La familia no permitió la necropsia y no nos informaron de nada mas.

Pero yo que soy del sur, sabia que había algo mas y tuvieron que pasar varios años, para que en una charla inesperada, la Dra Español que tampoco sabia nada de mi actuación , ni me conocía, hablara del tema.

Esto que describo la recojo de Internet

En el Vall d’Hebron se diagnosticó en octubre de 1981 el primer caso de VIH del Estado: un joven de 35 años que ingresó con sarcoma de Kaposi y otras infecciones oportunistas. La Dra. Carmen Navarro, entonces responsable de sección de Anatomía Patológica, ayudó a realizar el diagnóstico. La biopsia de lo que se pensaba que era un tumor resultó ser una infección por toxoplasmosis. Fue la primera vez que este parásito se asociaba al VIH. El hallazgo ayudó a realizar diagnósticos posteriores. Actualmente, el sida es una enfermedad crónica. Entre los retos, curar la enfermedad, reducir los contagios y tratar a los y las pacientes que llegan a la vejez.

07/10/2021

Hace 40 años, en octubre de 1981, el Hospital Universitari Vall d’Hebron diagnosticó el primer caso de sida del Estado. Un joven de 35 años que ingresó con una historia corta de dolor de cabeza persistente, lesiones de color púrpura y Sarcoma de Kaposi, un tipo de cáncer de piel provocado por un herpes virus (el VHH-8). Se trata de una enfermedad oportunista que aparece cuando el sistema inmunitario está en baja forma y que pronto se asoció al VIH. El paciente se había adelgazado mucho en los últimos seis meses. Una vez hospitalizado, los dolores de cabeza fueron en aumento y una parte del cuerpo se le paralizó. Para llegar al diagnóstico, se le hizo un escáner y el equipo médico identificó un tumor de tres centímetros en el cerebro que se interpretó como una metástasis. Lo operaron de urgencia, pero cuatro días después de la intervención el paciente perdió la vida.

La Dra. Carmen Navarro, que entonces era jefa de Sección de Anatomía Patológica de Vall d’Hebron, fue la encargada de analizar el tumor y realizar la autopsia neurológica. “En vez de células tumorales, encontré células parasitadas que asocié a una toxoplasmosis”, explica por teléfono desde su casa de Vigo. “El examen microscópico confirmó que el paciente tenía toxoplasmosis granulomatosa. Era un hallazgo sorprendente porque se trataba de una infección que solo se daba en neonatos”, destaca la Dra. Carmen Navarro.

Este fue el primer caso de VIH descrito en el Estado, pero también la primera vez que se asociaba la infección al cerebro por toxoplasma al sida. ”En el artículo que el equipo de Vall d’Hebron publicó en la revista The Lancet, donde describíamos el caso, relacionamos el brote de sarcoma de Kaposi y otras infecciones oportunistas que habían aparecido entre la población homosexual recientemente en los Estados Unidos con la infección por toxoplasma. Este detalle fue determinante para diagnosticar el sida a futuros pacientes”, recuerda la Dra. Carmen Navarro. En el artículo, también recogían que el paciente, a pesar de tener pareja estable en el momento de la infección, había tenido relaciones durante un viaje en Nueva York en 1974 y en Turquía con un joven norteamericano, en 1980. Igual que sucede con la COVID-19 y otras enfermedades infecciosas, el estudio de contactos ayudó a afinar el diagnóstico.

Entonces, todavía no se había bautizado la enfermedad como Síndrome de Inmunodeficiencia Adquirida (Sida). Todavía pasarían dos años para que en 1983, el virólogo francés Luc Montagnier, del Instituto Pasteur de París y Premio Nobel de Medicina 2008, aislara e identificara el virus que estaba causando estragos entre la población homosexual, sobre todo.

“Los primeros casos se detectaron en hombres que tienen sexo con hombres, pero la enfermedad no tardó en aparecer en pacientes con hemofilia o adicciones a las drogas y no solo hombres, también en mujeres, niños y niñas”, recuerda la Dra. Magda Campins. La actual jefa del grupo de investigación en Epidemiología y Salud Pública del Vall d’Hebron Instituto de Investigación (VHIR) empezó a trabajar en Vall d’Hebron hace 37 años. “Cada vez que se diagnosticaba un caso, hacíamos los estudios de los contactos. Eran tiempos en los que el VIH era una enfermedad estigmatizada y comunicarlo a los contactos y a la familia era muy duro. Tampoco era sencillo el papel de los sanitarios cuando no se sabía cómo se transmitía. La asociación de la enfermedad los primeros años al colectivo homosexual y la homofobia estigmatizó a los pacientes, y la desinformación y falta de respuesta científica no ayudó a frenar el rechazo social”, reflexiona la Dra. Magda Campins, que pese a que las expectativas de vida de los y las pacientes con VIH han cambiado, insiste en utilizar medidas para evitar la transmisión. En el Estado, se calcula que hay 3.000 nuevas infecciones cada año y 150.000 enfermos.

La Dra. Carmen Navarro, aunque no se dedicara después al VIH, recuerda aquellos años como “terribles”. “A partir del primer caso, el goteo de casos que combinaban infecciones oportunistas fue constante. Se nos morían sin poder hacer mucho. Cogimos conciencia rápidamente de la llegada de una nueva enfermedad que empezó afectando la población homosexual pero con el tiempo se convertiría en pandemia”, describe. En 40 años, el sida se ha cobrado la vida de 35 millones de personas. Todavía ahora, cada año se infectan 1,5 millones de personas y 38 millones de personas conviven con el virus. Pese a investigarse desde hace cuatro décadas, sigue sin haber cura. “No se ha encontrado una vacuna porque el virus del sida cuando se replica en las células tiene una gran habilidad para crear mutaciones, para hacerse una idea, hasta 6.000 veces más que un virus de la gripe, y esto pone palos en las ruedas para encontrar una vacuna eficaz”, explica la Dra. María José Buzón, responsable de la línea de Investigación Traslacional del VIH en el grupo de investigación en Enfermedades Infecciosas del VHIR. Gracias a los tratamientos es una enfermedad crónica, pero todavía mueren 690.000 personas cada año en países de renta mediana y baja.

Nuevos tratamientos, nueva esperanza de vida

“Hasta el 1987, que aparece el primer antirretroviral, AZT, un fármaco que impide la replicación del virus, no podíamos hacer mucho para los pacientes. Pero a pesar de que parecía que mejoraría su supervivencia, esta primera familia de antirretrovirales era muy tóxica. No es hasta el año 1996 que cambia la historia y el pronóstico de la enfermedad, cuando aparece un cóctel de tres fármacos que revierte la mortalidad”, explica el Dr. Vicenç Falcó, jefe del Servicio de Enfermedades Infecciosas del Hospital Universitari Vall d’Hebron e investigador del grupo de investigación en Enfermedades Infecciosas del VHIR. Durante los siguientes diez años, el tratamiento funcionaba con sus inconvenientes: se tenían que tomar muchas pastillas, seguía teniendo una toxicidad alta e interaccionaba con otros medicamentos. En 2005, aparecieron tratamientos más eficaces y menos tóxicos. Pero el salto cualitativo llegaría entre 2012 y 2015. “Aparece una nueva familia de medicamentos que solucionan tres problemas: baja la toxicidad, son fáciles de tomar y no tienen interacciones”, resume el Dr. Vicenç Falcó. “Actualmente, nos encontramos ante una enfermedad crónica, con la que los enfermos tienen una supervivencia similar al resto de la población”, describe. Aun así todavía quedan retos. El primero es curar el sida. El segundo, diagnosticar la enfermedad a las personas que no saben que están infectadas. El tercero, la prevención. Hay fármacos preventivos (la PrEP o terapia de preexposición) que evitan el contagio, se administran moléculas antirretrovirales a personas con probabilidades de infectarse, pero estas terapias no son accesibles en países en vías de desarrollo. El Programa de Drassanes Express, ubicado en el CAP de Drassanes de Barcelona, ayuda a detectar y tratar la infección y reducir su incidencia. El último reto será seguir teniendo cura de la gente infectada que se hace mayor. En Occidente, el 50% de los infectados tiene más de 50 años.

Para curar el sida, hay dos vías mayoritarias de investigación: conseguir una vacuna preventiva o nuevas estrategias de tratamiento que permitan eliminar el virus. “Todo este conocimiento ha ayudado a desarrollar con celeridad una vacuna y estrategias contra la COVID-19 y ahora esperamos recoger los frutos”, dice la Dra. Maria José Buzón. Ella y la Dra. Meritxell Genescà, investigadora del Grupo de investigación en Enfermedades infecciosas del VHIR, están al frente de las diferentes líneas de investigación del VHIR, centradas en la estrategia “shock and kill”: reactivar el virus latente y atacarlo. “El virus del sida es muy hábil porque se esconde en estado latente en reservorios, de forma que es capaz de burlar los tratamientos antirretrovirales y al sistema inmunitario. La persona infectada corre el peligro de que los reservorios se activen con una infección como un resfriado y empiece a reproducir virus a millones. Por eso, el tratamiento con antirretrovirales no se puede dejar nunca”, explica la Dra. Maria José Buzón.

En su laboratorio estudian varias estrategias. Activar el virus con un compuesto inocuo, el ácido láurico, para que el sistema inmunitario identifique y ataque el invasor. Potenciar las células NK con anticuerpos biespecíficos que también reconocen las células infectadas, o diseñar una nanopartícula para dirigirla a los ganglios linfáticos, uno de los reservorios donde se acumulan virus, para llevar fármacos capaces de reactivar virus del VIH latentes, son algunos ejemplos.

Esta objeción mía, no tiene más sentido que la estupidez humana, sin saber porque, se comportan como “raros”, pero vamos esto no sirve para nada.

Los participantes en el acto, fueron listos, ocultaron a unos actores, lo que nos les Valia para nada.

Ni ellos lo operaron ni siquiera lo curaron.

Lo Operamos Alejando y Yo, y sin la pieza quirúrgica, no se hubieran enterado del primer caso de SIDA en España.

Como dicen los toreros “Que Dios reparta suerte”

 

 

DSTYK EN CÁNCER DE PULMÓN

DSTYK EN CÁNCER DE PULMÓN

Un grupo de investigadores españoles detecta que la inhibición de la proteína DSTYK podría eliminar la resistencia de las células cancerosas a los fármacos. Descubren el ‘talón de Aquiles’ del cáncer de pulmón

Proteína recombinante con etiqueta GST en N-terminal Se utiliza para AP, matriz, ELISA, WB-Re Marca: Abnova™ H00025778-Q01.10ug Detalles adicionales : Peso : 0.00010kg

Este gen, codifica una proteína quinasa dual serina/treonina y tirosina que se expresa en múltiples tejidos. Se cree que funciona como un regulador de la muerte celular. Se han encontrado múltiples variantes de transcripción que codifican diferentes isoformas para este gen.

Secuencia: DVAETGLQAGQLSCISFPPKEEKYLQQIVDCLPCILILGQDCNVKCQLLNLLLGVQVLPTTKLGSEESCKLRRLRFTYGTQTRVSLALPGQYELVHTLVAHQGNWETIPE

Investigadores del Cima Universidad de Navarra han logrado que los tumores de pulmón resistentes a la inmunoterapia respondan al tratamiento, al descubrir que su ‘talón de Aquiles’ está en la inhibición de DSTYK, un tipo de proteína involucrada en el desarrollo tumoral. El informe de la Sociedad Española de Oncología Médica asegura que en 2022 en España se diagnosticarán 30.948 nuevos casos de esta enfermedad, según cita el Cima, que añade que en la última década ha mejorado la supervivencia al cáncer de pulmón gracias a estrategias de prevención, detección precoz y a la mejora de estrategias terapéuticas basadas en la medicina personalizada y la inmunoterapia. Sin embargo, aún hay pacientes que no responden a estas terapias.

La proteína se encuentra alterada en un porcentaje elevado de pacientes, lo que la convierte en una nueva diana terapéutica para el tratamiento de esta enfermedad, principal causa de muerte relacionada con el cáncer en el mundo

Este estudio reconoce por primera vez la dependencia entre la proteína DSTYK y el cáncer de pulmón, un hallazgo que “permite identificar a aquellos pacientes que no van a responder a la inmunoterapia”. La inhibición de DSTYK mejora la respuesta a la inmunoterapia en pacientes  con cáncer de pulmón | Dciencia

La autofagia  es el proceso por el que la célula descompone y destruye proteínas viejas, dañadas o anormales, y otras sustancias en su citoplasma (líquido en el interior de la célula). Los productos de la descomposición se reciclan para funciones celulares importantes, en especial durante períodos de estrés o ayuno. La autofagia también ayuda a destruir virus y bacterias que causan infección y quizás impida que las células normales se vuelvan cancerosas. Una vez que el cáncer se formó, es posible que la autofagia proteja a las células cancerosas brindando nutrientes o impidiendo que los medicamentos contra el cáncer u otras sustancias, las destruyan. La autofagia quizás afecte la respuesta inmunitaria contra los virus, las bacterias y las células cancerosas. Es un proceso por el que las células destruyen su propio contenido para sobrevivir. Controlarlo, puede ayudar a combatir la enfermedad.

La autofagia “alimenta y apoya el crecimiento de las células cancerosas y contribuye a la resistencia a los fármacos”. La proteína DSTYK ”es un regulador central de la autofagia. Al inhibir esta proteína el proceso de autofagia se colapsa logrando aumentar la sensibilidad de las células tumorales a las terapias basadas en la inmunidad”.

El cáncer de pulmón es la principal causa de muerte relacionada con el cáncer en el mundo. Según el último informe de la Sociedad Española de Oncología Médica, este tipo de cáncer es responsable del 18% de los fallecimientos por cáncer a nivel mundial.

“Este descubrimiento apoya la relevancia de esta proteína como diana terapéutica para avanzar en los esfuerzos de medicina personalizada para el tratamiento del cáncer de pulmón”, explica Valencia. De hecho, “priorizar esta nueva diana sentaría la base para el desarrollo de fármacos y ensayos clínicos que puede ampliar el porcentaje de pacientes que se benefician de los tratamientos basados en inmunoterapia”.

En este trabajo, que se publica en el último número de la revista científica Journal of Experimental Medicine, han colaborado investigadores de la Clínica Universidad de Navarra, de la Universidad Colonia y del Instituto de Oncología Vall d’Hebron de Barcelona. Varios de los investigadores de este trabajo pertenecen al Centro de Investigación Biomédica en Red en Cáncer (CIBERONC) y al Instituto de Investigación Sanitaria de Navarra (IdiSNA).

Referencias

Karmele Valencia, investigadora del Programa de Tumores Sólidos del Cima y primera autora del artículo.

Luis Montuenga, investigador del Programa de Tumores Sólidos del Cima

Journal of Experimental Medicine,. Centro de Investigación Biomédica en Red en Cáncer (CIBERONC) y al Instituto de Investigación Sanitaria de Navarra (IdiSNA).

 

LESIONES FRONTALES Y CAMBIOS DE CONDUCTA.

  1. LESIONES FRONTALES Y CAMBIOS DE CONDUCTA.

Tardo mucho la ciencia en asociar los trastornos psíquicos con lesiones cerebrales, hasta que hace ya casi un siglo y medio un accidente de trabajo y una severa lesión frontal, mostro como un paciente con muy poco trastorno corporal, se siguió de un severo y persistente cambio psiquico

El caso de Phineas Gage Y El Meningioma bifrontal de Elliot

Se llamaba Phineas P. Gage, era barrenero en Cavendish, Vermont, y trabajaba en la construcción del ferrocarril Rutland & Burlington Railroad, y murió el 21 de mayo de 1860 cerca de San Francisco, más o menos 12 años después del día en que debió morir y se salvó. Aquel día, estaba Gage colocando un barreno. Primero, hizo con una barra de hierro un agujero estrecho y profundo en la roca. Después, rellenó el agujero con pólvora, un detonador y arena. Y, finalmente, apretó y compactó la carga con la barra de hierro. Entonces, inesperadamente, a las 16.30 horas, la carga explotó, quizá porque olvidó, no se sabe con certeza, poner la arena. La barra de hierro salió disparada y alcanzó a Gage, de abajo arriba, entrando por el pómulo izquierdo, por debajo del ojo, y saliendo por el centro de la cabeza, más atrás de la frente, al inicio de la cabellera. La barra medía 1.10 metros, tenía 3.2 centímetros de diámetro y pesaba casi 6 kilos. Después de la explosión y manchada de “sangre y cerebro”, la barra terminó a unos 30 metros del lugar del accidente. Y Gage no murió. Sin embargo, aunque físicamente parecía recuperado, su carácter había cambiado, no se reincorporó a su trabajo y sus compañeros decían que “nunca más fue Gage”. En los años siguientes realizó varios trabajos manuales, fue conductor de diligencias, viajó por Nueva Inglaterra e, incluso, vivió y trabajó varios años en Valparaíso, en Chile.

Antes del accidente, Gage, aunque no había ido a la escuela, era un trabajador hábil, especializado, rápido, con una mente equilibrada, enérgico y perseverante. Su conducta cambió tras el accidente por los daños que la barra de hierro hizo en su cerebro. El caso de Phineas Cage 2

El otro dato significativo es que Gage sufrió un falso síndrome de Diogenes, lo acumulaba todo. Pero lo significativo es que perdió el concepto de las costumbres sociales

EL MENINGIOMA BIFRONTAL DE ELLIOT

Elliot había sido buen marido y padre, trabajado en una empresa, cumplido el rol de modelo para sus hermanos menores y colegas. Pero se le complicó la vida: empezó a padecer agudísimas migrañas y pronto le fue dificil concentrarse. A medida que empeoraba su condición, pareció ir perdiendo su sentido de la responsabilidad y otros le debían completar el trabajo.

Fue diagnosticado de un meningioma, del tamaño de una naranja que comprimía hacia arriba los lóbulos frontales.

Fue operado por un excelente equipo médico.

Como es habitual en estos casos, los lobulos frontales quedaron dañados.

Los cambios, que empezaron durante su convalecencia, asombraron a sus familiares y amigos. Si bien la destreza y la capacidad de Elliot para moverse sin trabas y hablar correctamente estaban intactas,.

Pero su vida diaria cambio obstensiblemente, había que insistirle para que se levantara y se fuera a trabajar. Una vez en su empleo, era incapaz de administrar correctamente su tiempo; no se le podía confiar un programa: cuando había que interrumpir el trabajo y pasar a otra tarea, seguía insistiendo y parecía perder de vista el objetivo principal. O interrumpía la actividad que estaba desarrollando, para concentrarse en otra cosa que le parecía más interesante en ese momento. Elliot leía y entendía perfectamente el archivo, y por cierto sabía clasificar de manera adecuada los documentos atendiendo a la similitud o disparidad de su contenido. El problema era que frecuentemente dejaba de lado la selección para interesarse durante todo el día en la lectura de uno de los documentos, lo que hacía con gran atención, cuidado e inteligencia. O bien se pasaba una tarde entera deliberando sobre el método de clasificación más adecuado.

Sobrevivían sus conocimientos básicos, y estaba capacitado para cumplir distintas tareas tan bien como antes. Pero no se le podía confiar que desarrollara una labor precisa cuando se le pedía que lo hiciera. Comprensiblemente, después que varias admoniciones de colegas y superiores cayeran en el vacío, fue despedido.

Su competencia para tomar decisiones estaba deterioradas, así como su talento para planificar correctamente su trabajos.

Pese a contar con las pruebas de los resultados desastrosos de sus resoluciones, era impermeable a la experiencia. Parecía más allá de toda redención, como el criminal recalcitrante que, aparentemente arrepentido, sale de la cárcel para cometer otro delito. Se puede afirmar que su libre arbitrio estaba comprometido, el libre arbitrio de Gage también había quedado comprometido.

Igual que Gage, contrajo hábitos de coleccionista. En otros sentidos, sin embargo, Elliot era diferente. A lo que parece, era menos nervioso que Gage y jamás decía groserías. Todavía no he podido aclarar, de modo empírico, si esas diferencias se deben a la localización ligeramente distinta de las lesiones, a la influencia de diversos antecedentes socioculturales, a un tipo premórbido de personalidad, o a la edad.

La tomografía computarizada y la resonancia magnética practicadas en Elliot revelaron que ambos lóbulos frontales habían sufrido, y que el daño era mucho más pronunciado en el derecho que en el izquierdo. De hecho, la superficie externa del lóbulo frontal izquierdo estaba incólume, y el deterioro en esa región se circunscribía a los sectores orbitales y mediales. Los mismos sectores estaban lesionados en el lado derecho, pero además estaba destruido el elemento central (materia blanca bajo la corteza cerebral) del lóbulo frontal. Debido al destrozo, gran parte de las capas corticales frontales no eran viables funcionalmente.

Las zonas responsables del movimiento (motoras y premotoras) en el lóbulo frontal quedaron intactas en ambos lados. No sorprendía, por lo tanto, que los movimientos de Elliot fueran plenamente normales.

Los estratos frontales relacionados con el lenguaje (área de Broca y sus alrededores) estaban indemnes. La región posterior a la base del lóbulo frontal, el prosencéfalo basal, también estaba ilesa. Esa zona, entre otras, es esencial para el aprendizaje y la memoria; si se hubiera lesionado, la memoria de Elliot habría quedado disminuida.

El daño se limitaba a las capas corticales prefrontales. Igual que en Gage, los sectores ventromediales de esas capas corticales habían sufrido la destrucción más intensa. Las lesiones del cerebro de Elliot eran sin embargo más extensas en el lado derecho que en el izquierdo.

Podríamos pensar que la masa cerebral destruida fue pequeña; una gran porción quedó incólume. Sin embargo, la amplitud del daño suele no ser lo más importante cuando se consideran las consecuencias de una lesión cerebral. El cerebro no es un amontonamiento de neuronas que hacen siempre lo mismo estén donde estén. Las estructuras destruidas en Gage y Elliot fueron precisamente las que requiere el razonamiento que culmina en la toma de decisiones.

La alteración de su conducta se había atribuido con frecuencia a defectos de memoria o de atención. Elliot me cambiaría esas nociones.

Lo habían evaluado previamente en otra institución que opinó que no había indicios de un «síndrome orgánico cerebral». En otras palabras, no mostraba señales de disminución cuando era sometido a exámenes típicos de inteligencia.

Su cociente intelectual estaba en el rango superior, y no parecía anormal en la Escala de Inteligencia Adulta de Wechsler. Decretaron que sus problemas no resultaban de ningún «padecimiento orgánico» o «disfunción neurológica», sino que reflejaban dificultades de ajuste «emocional» y «psicológico» —en otros términos, problemas mentales— y que por ende era tratable con psicoterapia.

El detalle con que Damásio describe los casos de Gage y de Eliot son extraordinarios lo único que lo enturbia es saber que las lesiones cerebrales, traumáticas o tumorales, no son puntuales, sino que se acompañan de severo daño a las partes que rodean la lesión principal. Es decir toda lesión cerebral es siempre difusa.

No obstante estos dos casos son significativos de como lesiones frontales, bilaterales, cursan con trastornos severos de la conducta.

El síndrome frontal es un término amplio que abarca diversos cambios conductuales en los pacientes lesionados. La variabilidad de los síntomas es debida a las características de la lesión (lateralidad, extensión, localización y ritmo de la progresión de la lesión), según dónde y cómo se encuentre la lesión, el paciente manifestará unos síntomas u otros.

Blumer y Benson (1975) hablaron de dos síndromes frontales que podemos relacionar como la psicopatología: la pseudo-depresión y la pseudo-psicopatía (en esta última podríamos clasificar a Phineas Gage).

Pseuo-depresión Pseudo-psicopatía
Hipocinesia Acciones desinhibidas
Apatía Actitud pueril, jocosa
Falta de impulso Hipercinesia
Indiferencia Desinhibición sexual
Falta de planificación Agitación, impulsividad
Ausencia de motivación Irritabilidad
Falta de juicio social
Autoindulgencia

Por hacer un resumen, posiblemente la región intracerebral donde existen mayor incidencia de patología siquiátrica, son los lóbulos frontales .

El caso que nos ocupa, proporcionaba un sintoma psiquico persistente.

Una de las características más comunes del daño del lóbulo frontal es la dificultad para interpretar la retroalimentación del entorno. La perseverancia en una respuesta (Milner, 1964), la asunción de riesgos y el incumplimiento de las reglas (Miller, 1985) y el deterioro del aprendizaje asociado (usar señales externas para ayudar a guiar el comportamiento) (Drewe, 1975) son algunos ejemplos de este tipo. de déficit.

También se cree que los lóbulos frontales desempeñan un papel en nuestra orientación espacial, incluida la orientación de nuestro cuerpo en el espacio (Semmes et al., 1963).

Lo anterior es la consecuencia de haber leído una trabajo impresionante del neuropsicólogo Saúl Martínez Horta sobre un meningioma frontal y la sola manifestación clínica de comprar y gastar.

Dilapida 200.000 euros en compras absurdas a causa de un tumor cerebral

Imágenes del cerebro de la paciente en las que se observa el enorme tumor del lóbulo frontal Imágenes del cerebro de la paciente en las que se observa el enorme tumor del lóbulo frontal

Se gastó la herencia familiar de forma compulsiva y siguió endeudándose con créditos

Un tumor cerebral de un tamaño mayor al de una pelota de tenis estaba detrás del trastorno de conducta de una barcelonesa de 65 años que dilapidó toda la fortuna familiar y se endeudó en compras compulsivas que hacía en internet a través del ordenador y del teléfono móvil. A lo largo de dos años, la mujer se gastó una herencia de 200.000 euros en adquirir, entre otros artículos, cientos de pares de zapatos. Después, cuando se arruinó, pidió en secreto créditos bancarios (que le fueron concedidos) para seguir adquiriendo cosas absurdas que iba amontonando en su casa.

Aunque el patrón de este repentino cambio en su conducta (la mujer no tenía antecedentes de problemas mentales) era el de los gastos sin ton ni son, el descontrol alcanzó el punto de que la señora comía de la basura abandonando todo hábito higiénico, acumulaba objetos que recogía de la calle y salía de casa a horas intempestivas. Un comportamiento grotesco.

Por los servicios de salud mental por donde pasó (la vieron y la siguieron tanto en psicología clínica como en psiquiatría), el diagnóstico siempre era el mismo: un trastorno por acumulación y una adicción a las compras, por lo que la incluyeron en un programa terapéutico. «Es extraño que alguien sin ningún antecedente previo, sin una historia de problemas similares debute de pronto y a esa edad con semejante trastorno. Había señales de alerta que podían indicar otra cosa», cuenta el neuropsicólogo Saúl Martínez Horta, que fue el que dio con la tecla cuando la recibió en su consulta del CDINC, un centro privado de Barcelona especializado en enfermedades neurodegenerativas y trastornos cognitivos.

«Cuando yo la vi era una mujer de aspecto normal, aunque algo dejado, a quien parecía hacerle mucha gracia estar en mi consulta acompañada de su hija. Sabía explicar perfectamente lo que había estado haciendo con el dinero y las compras, aunque no sabía explicar muy bien ni cuando, ni cómo, ni por qué empezó. Tampoco sabía explicar qué la llevaba a comprar todas esas cosas absurdas. Sabía que había arruinado a su familia, que se había gastado más de 200.000 euros en compras… pero eso no le producía ninguna emoción. Era un aplanamiento emocional total al confrontarla con la situación. Un aplanamiento que le había ido quitando las ganas de todo menos de comprar y de gastar. Mantenía en la consulta un contacto infantil, minimizando con risas y gestos propios de un niño todo lo que íbamos poniendo sobre la mesa. Risas e indiferencia que obviamente chocaban de lleno con los gestos de rabia y desesperación de su hija», ilustra el médico en un hilo de Twitter donde describe este caso clínico a sus casi 40.000 seguidores.

Llama la atención lo poco que se relaciona la patología psiquiátrica con lo orgánico, y claro asi pasa lo que pasa. Y el curso tan bondadoso que proporciono la intervención. No es lo habitual, separar el Meningioma, del tejido cerebral sano, y pese la pericia del cirujano, es imposible respetar e tejido sano.

Solo lo explico, porque no era medial el tumor sino de un lado y aparentemente respetaba el otro lóbulo frontal.

Las lesiones frontales invalidantes psíquicamente afectan ambos lóbulos frontales. Son los casos antes meniconado de Gage y Hess

Lo que desde mi comoda postura invito a los medicos a pensar mas en lo orgánico.

Referencias:

José A Guerrero Madrid / Colpisa

Blumer, D., & Benson, D. Cambios de personalidad con lesiones del lóbulo frontal y temporal. En D. Benson y D. Blumer, eds. Aspectos psiquiátricos de la enfermedad neurológica. Nueva York: Grune & Stratton, 1975.

Brown, J. Afasia, apraxia y agnosia. Springfield, IL: Charles C. Thomas, 1972.

Drew, E. (1975). Aprendizaje go-no-go después de una lesión del lóbulo frontal en humanos. Corteza, 11:8-16.

Kolb, B. y Milner, B. (1981). Realización de movimientos faciales y de brazos complejos después de lesiones cerebrales focales. Neuropsicología, 19:505-514.

Kuypers, H. Anatomía de las vías descendentes. En V. Brooks, ed. El Sistema Nervioso, Manual de Fisiología, vol. 2. Baltimore: Williams y Wilkins, 1981.

Leonard, G., Jones, L. y Milner, B. (1988). Deterioro residual en la fuerza de prensión manual después de lesiones unilaterales del lóbulo frontal. Neuropsicología, 26:555-564.

Levin et al. (1987). La resonancia magnética y la tomografía computarizada en relación con las secuelas neuroconductuales de los traumatismos craneoencefálicos leves y moderados. Revista de Neurocirugía, 66, 706-713.

Molinero, L. (1985). Toma de riesgos cognitivos después de la lobectomía frontal o temporal. I. La síntesis de información visual fragmentada. Neuropsicología, 23:359-369.

Milner, B. Algunos efectos de la lobectomía frontal en el hombre. En J. Warren y K. Akert, eds. La corteza granular frontal y el comportamiento. Nueva York: McGraw-Hill, 1964.

Semmes, J., Weinstein, S., Ghent, L. y Teuber, H. (1963). Deterioro de la orientación en el espacio personal y extrapersonal. Cerebro, 86:747-772.

Stuss, D. et al. (1985). Déficits neuropsicológicos sutiles en pacientes con buena recuperación después de un traumatismo craneoencefálico cerrado. Neurocirugía, 17, 41-47.

Walker, E. y Blumer, D. La localización del sexo en el cerebro. En KJ Zulch, O. Creutzfeldt y G. Galbraith, eds. Localización cerebral, Berlín y Nueva York: Springer-Verlag, 1975.

Blumer, D., & Benson, D. Cambios de personalidad con lesiones del lóbulo frontal y temporal. En D. Benson y D. Blumer, eds. Aspectos psiquiátricos de la enfermedad neurológica. Nueva York: Grune & Stratton, 1975.

Brown, J. Afasia, apraxia y agnosia. Springfield, IL: Charles C. Thomas, 1972.

Drew, E. (1975). Aprendizaje go-no-go después de una lesión del lóbulo frontal en humanos. Corteza, 11:8-16.

Kolb, B. y Milner, B. (1981). Realización de movimientos faciales y de brazos complejos después de lesiones cerebrales focales. Neuropsicología, 19:505-514.

Kuypers, H. Anatomía de las vías descendentes. En V. Brooks, ed. El Sistema Nervioso, Manual de Fisiología, vol. 2. Baltimore: Williams y Wilkins, 1981.

Leonard, G., Jones, L. y Milner, B. (1988). Deterioro residual en la fuerza de prensión manual después de lesiones unilaterales del lóbulo frontal. Neuropsicología, 26:555-564.

Levin et al. (1987). La resonancia magnética y la tomografía computarizada en relación con las secuelas neuroconductuales de los traumatismos craneoencefálicos leves y moderados. Revista de Neurocirugía, 66, 706-713.

Molinero, L. (1985). Toma de riesgos cognitivos después de la lobectomía frontal o temporal. I. La síntesis de información visual fragmentada. Neuropsicología, 23:359-369.

Milner, B. Algunos efectos de la lobectomía frontal en el hombre. En J. Warren y K. Akert, eds. La corteza granular frontal y el comportamiento. Nueva York: McGraw-Hill, 1964.

Semmes, J., Weinstein, S., Ghent, L. y Teuber, H. (1963). Deterioro de la orientación en el espacio personal y extrapersonal. Cerebro, 86:747-772.

Stuss, D. et al. (1985). Déficits neuropsicológicos sutiles en pacientes con buena recuperación después de un traumatismo craneoencefálico cerrado. Neurocirugía, 17, 41-47.

Walker, E. y Blumer, D. La localización del sexo en el cerebro. En KJ Zulch, O. Creutzfeldt y G. Galbraith, eds. Localización cerebral, Berlín y Nueva York: Springer-Verlag, 1975.

 

LA NEUROFIBROMATOSIS

LA NEUROFIBROMATOSIS)

La neurofibromatosis es un síndrome neurocutáneo

La neurofibromatosis se refiere a varios trastornos relacionados que tienen manifestaciones clínicas que se solapan, que tienen causas genéticas distintas. Esto causa varios tipos de tumores benignos o malignos que afectan nervios centrales o periféricos y a menudo causa máculas pigmentadas de la piel y, a veces otras manifestaciones. El diagnóstico es clínico. No existe un tratamiento específico, pero los tumores benignos se puede extirpar quirúrgicamente, y los tumores malignos (que son menos comunes) puede ser tratados con radioterapia o quimioterapia.

Hay 3 tipos principales de neurofibromatosis (NF): NF1, NF2 y schwannomatosis, que son causadas por mutaciones de genes.

La NF1 provoca en forma típica alteraciones cutáneas, neurológicas y óseas, pero puede afectar casi cualquier parte del cuerpo.

NF2 produce neurinomas bilaterales del acústico.

La schwannomatosis provoca múltiples schwannomas no intradérmicos; no causa neurinomas del acústico.

El diagnóstico se realiza mediante criterios clínicos; se realizan neuroimágenes si los pacientes tienen anomalías neurológicas.

No existe un tratamiento específico, pero los neurofibromas que causan síntomas graves se puede extirpar quirúrgicamente.

Los tumores malignos pueden requerir quimioterapia.

La neurofibromatosis tipo 1 (NF1, o enfermedad de von Recklinghausen) es más frecuente y ocurre en 1 de 2.500 a 3.000 personas. Esta enfermedad causa manifestaciones neurológicas, cutáneas y, a veces, óseas o de partes blandas. El gen de la NF1 se encuentra en la banda 17q11.2 y codifica la síntesis de neurofibromina; se han identificado > 1.000 mutaciones. Aunque es un trastorno autosómico dominante, 20 a 50% de los casos son causados por una mutación de células germinales de novo.

La neurofibromatosis tipo 2 (NF2) representa el 10% de los casos y se presenta en aproximadamente 1 de 35.000 personas. Se manifiesta principalmente como neuromas acústicos bilaterales congénitos (schwannomas vestibulares). El gen de la NF2 se encuentra en la banda 22q11 y codifica la síntesis de merlina, un supresor de tumores; se han identificado 200 mutaciones. La mayoría de las personas con NF2 lo han heredado de uno de sus padres.

La schwannomatosis, un trastorno poco común, se clasifica como tercer tipo de neurofibromatosis. En 15% de los casos, este tipo es familiar y está relacionado con una mutación germinal en el gen SMARCB1, un gen supresor tumoral localizado en el cromosoma 22q11.23, muy cerca del gen NF2. En los casos restantes, no se conoce bien la base genética, pero en el tejido de algunos pacientes, otras mutaciones del mismo gen están involucradas. Dos o más schwannomas se desarrollan en los nervios vertebrales y en los nervios periféricos y son a veces muy dolorosos; sin embargo, no se desarrollan los neuromas acústicos. La schwannomatosis solía ser considerada una forma de NF2 porque hay múltiples schwannomas en ambas condiciones; sin embargo, el cuadro clínico es diferente, y los genes implicados son distintos.

Neurofibromas periféricos y centrales

Los tumores pueden ser periféricos o centrales.

Los tumores periféricos son frecuentes en la NF1 y pueden aparecer en cualquier lugar del recorrido de nervios periféricos. Los tumores son neurofibromas, que se desarrollan a partir de las vainas nerviosas y consisten en mezclas de células de Schwann, fibroblastos, células neurales y mastocitos. La mayoría aparece durante la adolescencia. De vez en cuando, se transforman en tumores malignos de la vaina nerviosa. Hay múltiples formas:

Los neurofibromas cutáneos son blandos y carnosos.

Los neurofibromas subcutáneos son duros y nodulares.

Los neurofibromas plexiformes nodulares pueden afectar las raíces de los nervios espinales y, en general, crecen hacia el agujero intervertebral para dar origen a masas intraespinales y extraespinales (tumor en reloj de arena). La parte intraespinal puede comprimir la médula espinal.

Los neurofibromas plexiformes difusos (nódulos subcutáneos o crecimiento amorfo excesivo del hueso o las células de Schwann subyacentes) pueden causar desfiguración y déficits distales al neurofibroma. Los neurofibromas plexiformes pueden malignizar y parecen ser los precursores más comunes de los tumores malignos de la vaina del nervio periférico en personas con NF1.

Los schwannomas derivan de las células de Schwann, rara vez sufren transformación maligna y pueden ocurrir en los nervios periféricos en cualquier parte del cuerpo.

Los tumores centrales tienen varias formas:

Gliomas ópticos: estos tumores son astrocitomas pilocíticos de bajo grado, que pueden ser asintomáticos o pueden progresar lo suficiente para comprimir el nervio óptico y causar ceguera. Se producen en los niños más pequeños; estos tumores pueden por lo general ser identificados hacia los 5 años y rara vez se desarrollan después de los 10 años. Aparecen en la NF1.

Neurinomas del acústico (schwannomas vestibulares): estos tumores pueden causar mareos, ataxia, sordera y acúfenos debido a la compresión del nervio craneal VIII; a veces causan debilidad facial debido a la compresión de la VII nervio adyacente. Ellos son el rasgo distintivo de la NF2.

Meningiomas: estos tumores se desarrollan en algunas personas, particularmente aquellos con NF2.

Signos y síntomas de la neurofibromatosis

Neurofibromatosis tipo 1 (NF1)

La mayoría de los pacientes con NF-1 son asintomáticos. Algunos presentan síntomas neurológicos o deformidades óseas. En > 90%, las lesiones cutáneas características son evidentes en el momento del nacimiento o aparecen durante la lactancia.

Las lesiones de café con leche son máculas similares a pecas de color café con leche, distribuidas la mayoría de las veces sobre el tronco, la pelvis y los pliegues flexores de codos y rodillas. Aunque los niños que no tienen neurofibromatosis pueden tener 2 o 3 manchas café con leche, los niños con NF1 tienen ≥ 6 de tales máculas y, a menudo muchas más. Estas máculas son > 5 mm en los niños prepúberes afectados y > 15 mm en los pacientes pospúberes (véase tabla Diagnóstico de la neurofibromatosis).

Son frecuentes los neurofibromas cutáneos que surgen a lo largo de pequeños nervios periféricos. Durante etapas tardías de la infancia, aparecen estos tumores cutáneos de color carne y tamaños y formas variables, que varían en número de varios a miles. Suelen ser asintomáticas.

Los neurofibromas plexiformes pueden desarrollarse y tienden a crecer hasta alcanzar grandes tamaños, lo que produce un engrosamiento irregular y distorsión de las estructuras, que a veces presentan deformidades grotescas responsables de la compresión de los nervios y otras estructuras. Los neurofibromas plexiformes también pueden involucrar a los nervios craneales, típicamente el V, el IX y el X.

Los síntomas neurológicos varían según la localización y el número de neurofibromas. Los neurofibromas más grandes pueden comprimir su nervio de origen y causar parestesias distales, dolor e hipoestesia o debilidad, dependiendo de la función del nervio que está involucrado. Los neurofibromas que se forman a lo largo de las raíces nerviosas espinales, especialmente donde las raíces nerviosas están contenidas por el hueso, pueden comprimir las raíces nerviosas y causar dolor radicular, debilidad o pérdida generalizada de la sensibilidad en esa distribución nerviosa. Los neurofibromas plexiformes que comprimen los nervios craneales causan déficits típicos de esos nervios.

Manifestaciones cutáneas de la neurofibromatosis tipo 1

Neurofibromas

Neurofibromas y manchas de café con leche (espalda)

Esta fotografía muestra múltiples neurofibromas (nódulos pardos en relieve) y manchas «café con leche» (manchas planas pardas) en la espalda de un paciente con neurofibromatosis.

DR HAROUT TANIELIAN/SCIENCE PHOTO LIBRARY

Neurofibromas

Neurofibromas y manchas de café con leche

Esta fotografía muestra neurofibromas (nódulos pardos en relieve) y manchas «café con leche» (manchas planas pardas) en un paciente con neurofibromatosis.

Imagen cortesía de Karen McKoy, MD.

Neurofibromatosis

Neurofibromatosis (máculas café con leche y neurofibromas)

Este paciente con neurofibromatosis tipo 1 tiene varias manchas de color café con leche (máculas hiperpigmentadas) y neurofibromas (nódulos levantados).

© Springer Science+Business Media

Manifestaciones

Manifestaciones cutáneas en la neurofibromatosis tipo 1 (NF1)

Esta fotografía muestra máculas axilares semejantes a pecas en la NF1.

© Springer Science+Business Media

Neurofibromatosis

Neurofibromatosis (máculas café con leche)

Estas lesiones son máculas con bordes netos presentes en la mayoría de los pacientes con neurofibromatosis de tipo 1 (NF1).

From Oster A, Rosa R: Atlas of Ophthalmology. Edited by R Parrish II and HW Flynn Jr. Philadelphia, Current Medicine, 2000.

Neurofibromatosis

Neurofibromatosis (Neurofibromas) La espalda y los brazos de este hombre de 69 años están cubiertos de pequeños neurofibromas, y hay una mancha café con leche justo medial a su escápula derecha.

Las alteraciones óseas son

Displasia fibrosa

Quiste óseos subperiósticos

Festoneado vertebral

Escoliosis

Adelgazamiento de la cortical de los huesos largos

Seudoartrosis

Ausencia del ala mayor del hueso esfenoides (pared posterior de la órbita), con el consiguiente exoftalmos pulsátil

Neurofibromatosis (anomalías esqueléticas)

Neurofibromatosis (anomalías esqueléticas)

 

Se observa un neuroma plexiforme en el brazo izquierdo de la paciente, que se extiende desde el húmero proximal hasta la mano. El húmero presenta múltiples fracturas diafisarias asociadas con adelgazamiento de la corteza ósea y seudoartrosis. La paciente también presenta escoliosis, baja talla y agrandamiento del conducto intramedular lumbar causado por meningocele anterior.

En algunos pacientes, se observan glioma óptico y nódulos de Lisch (hamartomas del iris). Los gliomas ópticos suelen ser asintomáticos y no requieren tratamiento a menos que aumenten progresivamente de tamaño.

Los pacientes con NF1 también pueden tener un síndrome de Moyamoya (estenosis u oclusión de las arterias en y alrededor del círculo de Willis con formación de pequeñas arterias colaterales), o aneurismas de la arteria intracraneal. Algunos niños tienen problemas de aprendizaje y ligera macrocefalia.

Neurofibromatosis (nódulos de Lisch)

Neurofibromatosis (nódulos de Lisch)

Ocultar los detalles

Los nódulos de Lisch en el iris son hamartomas melanóticos hiperpigmentados.

.

Los niños y adolescentes con NF1 pueden tener leucemia mielomonocítica crónica infantil (leucemia mielomonocítica juvenil) y rabdomiosarcoma. Los feocromocitomas pueden manifestarse a cualquier edad.

Los tumores malignos son mucho menos comunes, pero aún siguen siendo más frecuentes que en la población general; ellos incluyen los gliomas supratentoriales o del tronco cerebral y la transformación de neurofibromas plexiformes a los tumores malignos de la vaina nerviosa. Estos tumores pueden desarrollarse a cualquier edad.

Neurofibromatosis tipo 2 (NF2)

En la NF2 se desarrollan neuromas acústicos bilaterales y se tornan sintomáticos durante la infancia o la edad adulta temprana. Causan hipoacusia, inestabilidad y, a veces, cefalea o debilidad facial. Puede haber masas bilaterales en el octavo par craneal (nervio vestibulococlear). Los miembros de la familia pueden tener gliomas, meningiomas o schwannomas.

Schwannomatosis

En la schwanomatosis, múltiples schwannomas se desarrollan en los nervios craneales, espinales y periféricos. No se desarrollan neurinomas del acústico y los pacientes no se vuelven sordos. Además, los otros tipos de tumores que a veces se producen en los trastornos neurocutáneos no se desarrollan.

El primer síntoma de la schwanomatosis suele ser el dolor, que puede llegar a ser crónico e intenso. Se pueden desarrollar otros síntomas, lo que depende de la localización de los schwannomas.

Evaluación clínica

RM cerebral o TC de cráneo

La mayoría de los pacientes con NF1 se identifican durante exámenes sistemáticos, exámenes por consultas estéticas o evaluaciones de antecedentes familiares positivos. (Véase también guidelines for the diagnosis and management of individuals with NF1 del Consejo Asesor Clínico de la Neurofibromatosis Association del Reino Unido, guidelines for the health supervision of children with NF1 de una colaboración de expertos, clinical practice guidelines for the care of adults with NF1 del American College of Medical Genetics and Genomics.)

El diagnóstico de los 3 tipos es clínico ( ver Diagnóstico de neurofibromatosis) mediante una exploración física detallada centrada en los sistemas cutáneo, esquelético y neurológico. Debe sospecharse y vigilarse la presencia de NF1 en niños que tienen múltiples manchas café con leche, incluso si no tienen otras características o antecedentes familiares de NF1.

La RM cerebral se realiza en pacientes con síntomas o signos neurológicos y, cuando no es posible una evaluación visual detallada, en los niños más pequeños que cumplen los criterios clínicos para la NF1 y que pueden tener un glioma óptico. La RM ponderada en T2 puede mostrar engrosamiento o tortuosidad de los nervios ópticos y lesiones hiperintensas del parénquima que cambian con el tiempo y se correlacionan con pequeñas estructuras quísticas en NF1; la RM puede ayudar a identificar neuromas acústicos o meningiomas en la NF2. Si se sospecha un neuroma acústico, se puede realizar una TC de la cresta petrosa; que por lo general muestra ensanchamiento del conducto auditivo.

Las pruebas genéticas no se realizan normalmente en estos trastornos porque no todas las mutaciones son conocidas y los criterios clínicos son claros.

Tratamiento de la neurofibromatosis

Para los neurofibromas sintomáticos, posiblemente cirugía o extirpación con láser o electrocauterio

Para los tumores malignos, quimioterapia

No se dispone de un tratamiento general para la neurofibromatosis.

Los neurofibromas que causan síntomas graves pueden requerir resección quirúrgica o, si son pequeños, eliminación con láser o electrocauterio. La extirpación quirúrgica de los neurofibromas plexiformes puede anular la función del nervio afectado, y los neurofibromas tienen una tendencia a recurrir en el sitio de la extirpación. En la actualidad se llevan a cabo ensayos clínicos sobre varios tratamientos médicos para los neurofibromas plexiformes y espinales, como por ejemplo con el uso de Sirolimús.

La mayoría de los gliomas ópticos son asintomáticos y solo es necesario controlarlos para determinar su progresión. Tanto para los gliomas ópticos progresivos como para las lesiones del sistema nervioso central que se han vuelto malignas, la quimioterapia es el tratamiento de elección.

Si alguno de los progenitores tiene una neurofibromatosis, el riesgo para la descendencia ulterior es del 50%; si ninguno de los progenitores presenta la enfermedad, el riesgo de los hijos siguientes es incierto, porque son frecuentes las mutaciones nuevas, sobre todo en NF1.

Referencias

From Kotagal S, Bicknese A, Eswara M: Atlas of Clinical Neurology. Edited by RN Rosenberg. Philadelphia, Current Medicine, 2002.

From Bird T, Sumi S: Atlas of Clinical Neurology. Edited by RN Rosenberg. Philadelphia, Current Medicine, 2002

HAROUT TANIELIAN/SCIENCE PHOTO LIBRARY

From Kotagal S, Bicknese A, Eswara M: Atlas of Clinical Neurology. Edited by RN Rosenberg. Philadelphia, Current Medicine, 2002

 

OMOMYC FRENA EL CANCER

El OMOMYC FRENCómo funciona el fármaco OmomycA AL CANCER

Posiblemente el cáncer ha existido siempre aunque sin duda alguna en un número muy inferior a la actualidad.

¿Es un problema de biología o de ambiente se puede concluir que es de los dos no cabe duda que el ambiente profesional que vivo genera cancer y también qué animales muy primitivos que vivían en ambiente poco polucionados también tenían cáncer pero en mucho menor número.

Lo cierto es que a medida que se tienen más medios para investigar se conocen mejor los mecanismos íntimos de esta enfermedad

Hace 76 millones de años, un dinosaurio herbívoro de la especie Centrosaurus apertus —. Murió junto a otros miembros de su manada, probablemente ahogado por una fuerte riada. Pero la enfermedad que padecía le habría terminado matando: osteosarcoma, cáncer de huesos, en estado avanzado.

También en 2020 se ha descrito un posible tipo raro de cáncer llamado histiocitosis de células de Langerhans en un hadrosaurio, un dinosaurio con pico que vivió en el Cretácico. Según los autores del estudio del centrosaurio, “las pruebas sugieren que los cánceres malignos, incluidos los de hueso, están profundamente arraigados en la historia evolutiva de los organismos”.

BBVA-OpenMind-Materia-Enfermedad moderna o avería biológica Historia cancer 2-El peroné de Centrosaurus apertus, mostrando osteosarcoma. Crédito: Royal Ontario Museum/McMaster University El peroné de Centrosaurus apertus, mostrando osteosarcoma. Crédito: Royal Ontario Museum/McMaster University

A pesar de ello, a menudo escuchamos un mensaje algo diferente: que el cáncer es una enfermedad humana moderna, causada por los factores ambientales nocivos a los que nos expone nuestro modo de vida.

En 2010, dos investigadores de las universidades de Manchester y Villanova esgrimían la escasa detección de cánceres en las momias egipcias para concluir que “el cáncer era raro en la antigüedad, y por tanto plantea preguntas sobre el papel de los factores ambientales carcinogénicos en las sociedades modernas”.

La egiptóloga Rosalie David, “no hay nada en el entorno natural que pueda causar cáncer. Así que tiene que ser una enfermedad hecha por el hombre, debida a la contaminación y los cambios en nuestra dieta y estilo de vida”.

El estudio provocó una oleada de comentarios de respuesta. Expertos en cáncer rebatían las palabras de David aportando ejemplos de factores naturales carcinogénicos, desde la luz ultravioleta del sol a compuestos químicos hallados en mohos y plantas.

En su blog de la revista Science, el químico Derek Lowe advertía contra lo que llamaba el efecto del Jardín del Edén: la idea de que “había un tiempo —hace mucho— en que la gente estaba en armonía con la naturaleza, comía alimentos naturales puros y saludables (del tipo de los que se supone que debemos comer), y no tenía todos los horribles problemas que tenemos en estos degenerados tiempos modernos”.

Lo cierto es que no solo las primeras descripciones del cáncer, e incluso su mismo nombre, se remontan a la antigüedad de la Grecia clásica, sino que se han encontrado signos de la enfermedad en fósiles de homininos africanos de hasta 1,7 millones de años de edad. Y en cuanto a los animales, la idea de que ciertas especies jamás padecen cáncer tiene más de mito que de realidad: incluso en el Ratopín o rata topo desnuda, el animal que suele esgrimirse como ejemplo de este fenómeno, se han encontrado casos. En estos peculiares animales, un estudio reciente sugiere que sus células no son intrínsecamente más resistentes al cáncer que las de otras especies, sino que posiblemente existan otros factores inmunitarios o del microentorno celular que las protegen. Es decir, hay una vulnerabilidad natural de las células animales al cáncer, que los propios mecanismos internos luchan por prevenir.

Por ejemplo, en los elefantes, una especie con una baja incidencia de cáncer, se ha encontrado que su genoma posee múltiples copias de p53, un gen supresor de tumores conocido como el “guardián del genoma”, por mantener a raya las mutaciones dañinas. Estos y otros mecanismos celulares son los que nos muestran que el cáncer, más que una consecuencia de nuestra sociedad, lo es de nuestra biología; por ejemplo, el osteosarcoma hallado en el centrosaurio suele darse en los humanos durante la adolescencia, cuando los huesos crecen rápidamente. Los supresores de tumores se encargan de vigilar, pero no son infalibles.

En los elefantes, una especie con una baja incidencia de cáncer, se ha encontrado un gen supresor de tumores. Crédito: Diego Delso

El cáncer no es una enfermedad moderna, sino que ha estado presente tanto en humanos como en animales de forma muy temprana desde el comienzo de la vida”, sentencia a OpenMind el paleopatólogo del hospital académico Bogenhausen de Múnich Andreas Nerlich. Este experto, que ha estudiado la incidencia del cáncer en poblaciones antiguas de Egipto y la Edad Media sin encontrar grandes diferencias con las de la era industrial, reconoce que hoy la enfermedad es mucho más frecuente, pero le atribuye una causa: “Mayor esperanza de vida, y por ello posiblemente una incubación más larga de sustancias carcinogénicas e infecciones virales con posible influencia carcinogénica”.

El cáncer es una enfermedad propia de edades avanzadas”, remacha a OpenMind el investigador del Institute for Research in Biomedicine de Barcelona Manuel Serrano, experto en genes supresores de tumores. Serrano explica que esta es la causa de que en la antigüedad estas dolencias fueran menos frecuentes: “¡Llegar a los 50 también era muy raro! Antes llegaban pocos a los 80”. A ello se suma, añade Serrano, que antiguamente muchos casos pasaban inadvertidos: “Solo se diagnosticaba como cáncer aquel que se manifestaba externamente porque literalmente salía un bulto”.

Serrano apunta también que posiblemente los tipos de cánceres más frecuentes hayan cambiado respecto a tiempos más antiguos, dado que, abundando en el efecto del Jardín del Edén de Lowe, “la vida en la antigüedad no era la idealización que algunos tienen en mente”. “Se sabe que la gente inhalaba tóxicos en cantidades inimaginables debido a los fuegos que se hacían dentro de cuevas, chozas y cabañas”, expone. “Los niños, adultos y viejos, todos los días respiraban dentro de sus viviendas el humo del fuego”. Otro ejemplo que subraya Serrano son los alimentos, que en otros tiempos a menudo se consumían en mal estado. “Los alimentos podridos están llenos de bacterias y hongos que se sabe contienen agentes carcinogénicos”.

BBVA-OpenMind-Materia-Enfermedad moderna o avería biológica Historia cancer 4-Respuesta inmunitaria antitumoral. Crédito: NIH Respuesta inmunitaria antitumoral. Crédito: NIH

Por último, destaca el investigador, los fármacos actuales nos liberan de infecciones crónicas que también suponen un factor de riesgo de cáncer.

OMOMYC CONTRA EL CÁNCER CREADO EN VALL D’HEBRON

Actúa de manera diferente a cualquier otra terapia y podría ser útil para múltiples tumores

Imagen creada por ordenador de células tumorales

Getty Images/Science Photo Libra Imagen creada por ordenador de células tumorales

El fármaco experimental Omomyc, que actúa contra el cáncer de una manera distinta a cualquier medicamento anterior y que tiene el potencial de mejorar el tratamiento de múltiples tumores, ha obtenido resultados positivos de eficacia y de seguridad en su primer ensayo clínico en pacientes.

El equipo del Instituto de Oncología de Vall d’Hebron (VHIO) que ha desarrollado el Omomyc está en conversaciones con empresas farmacéuticas para iniciar ensayos clínicos más amplios a mediados de 2023. Los primeros tipos de tumores en los que tiene previsto realizar estos ensayos son de páncreas, pulmón y mama triple negativo.

El Omomyc actúa inhibiendo la proteína MYC, que estimula la multiplicación de las células y que está hiperactivada en la mayoría de los cánceres. Se trata del primer fármaco oncológico dirigido contra una proteína del núcleo de las células, a diferencia de las decenas de terapias moleculares dirigidas contra proteínas de la membrana, a las que es más fácil acceder.

Los resultados obtenidos hasta ahora “nos dan motivos para ser optimistas”, valora Laura Soucek, investigadora del VHIO que empezó a trabajar en la proteína MYC hace 25 años y que ha persistido hasta que ha conseguido desactivarla. Entre investigadores del cáncer, MYC era calificada de undruggable -imposible de tratar con fármacos-.

Elena Garralda y Laura Soucek han desarrollado el fármaco oncológico Omomyc, que ha superado con éxito su primer ensayo con pacientes. Se ha ensayado en la Unidad de Investigación de Terapias Moleculares (UITM) de Vall d'Hebron

Laura Soucek (izquierda) y Elena Garralda, en el Instituto de Oncología de Vall d’Hebron (VHIO)

Miquel González / Shooting / Colaboradores

En el ensayo clínico, iniciado en abril de 2021, han participado 22 pacientes con nueve tipos diferentes de cáncer. Todos ellos tenían metástasis, se les habían agotado las opciones de tratamiento y sus cánceres continuaban progresando. Se les administró Omomyc por vía endovenosa una vez por semana. El ensayo clínico se ha realizado en los hospitales Vall d’Hebron de Barcelona, Fundación Jiménez Díaz de Madrid y en el centro oncológico Clara Campal, también en Madrid.

Así funciona el Omomyc, el nuevo fármaco contra el cáncer

Como es habitual en los ensayos clínicos de fase 1, en que un nuevo tratamiento se administra por primera vez a personas, se empezó con dosis bajas y se fueron aumentando las cantidades hasta encontrar el punto de máxima eficacia con mínimos efectos secundarios.

Eficaz en casos distintos

La mejor respuesta se ha observado en un paciente con un tumor de glándulas salivales en los que la enfermedad está estabilizada desde hace 15 meses y que continúa en tratamiento, informa Elena Garralda, directora de la Unidad de Investigación de Terapia Molecular del Cáncer-CaixaResearch de Vall d’Hebron (UITM),que ha coordinado el ensayo clínico.

En otro paciente con sarcoma, se frenó la progresión del cáncer durante ocho meses. En pacientes con cáncer de páncreas, se estabilizó la enfermedad durante periodos de hasta seis meses, lo que ha supuesto un aumento de supervivencia para personas para las que no quedaba ningún otro tratamiento.

Cómo funciona el fármaco Omomyc

Según los resultados que se presentarán en un congreso sobre ensayos clínicos de cáncer que se inaugura hoy en Barcelona, el Omomyc ha conseguido que el cáncer dejara de progresar en aproximadamente la mitad de los pacientes. Concretamente, la enfermedad se estabilizó en ocho de los veintidós pacientes y no lo hizo en nueve, mientras que los otros cinco casos se consideran no evaluables (por ejemplo, porque murieron a los pocos días de iniciar el tratamiento).

El tratamiento ha sido bien tolerado por todos los pacientes excepto dos en los que ha sido necesario reducir la dosis debido a efectos secundarios.

En estos ensayos el Omomyc se administrará en combinación con otros tratamientos oncológicos. Si la terapia se inicia cuando la enfermedad no está tan avanzada, en un momento en que los pacientes aún tienen otras opciones de tratamiento, “esperamos que los resultados sean mejores que los del primer ensayo”, valora Soucek. Además, dado que el Omomyc inhibe la proliferación celular que favorece que el cáncer se vuelva resistente a los tratamientos, “esperamos conseguir un efecto de sinergia y que el Omomyc mejore la acción de otros fármacos”.

No se ha decidido aún con qué tipos de cáncer empezarán los ensayos clínicos de fase 2. Entre los primeros candidatos destaca el cáncer de páncreas, pues es un tipo de tumor en que la proteína MYC casi siempre está alterada, para el que faltan tratamientos eficaces y en el que los datos de los ocho pacientes tratados en el fase 1 han sido prometedores, informa Soucek. En este caso, el Omomyc se administraría en combinación con el tratamiento estándar de quimioterapia.

Un segundo candidato es el cáncer de pulmón no microcítico, que representa más del 80% de los cánceres de pulmón y que fue el primero en que se ensayó el Omomyc en ratones, con prometedores resultados que se presentaron en Science Translational Medicine. El nuevo fármaco se administraría entonces en combinación con terapias moleculares.

Finalmente, el equipo del VHIO espera poder realizar un ensayo clínico de fase 2 con cáncer de mama triple negativo, que es el tipo de cáncer de mama que dispone de menos opciones de tratamiento y para el que el Omomyc también ha obtenido resultados prometedores en ratones. Representa entre un 10% y un 15% de todos los cánceres de mama.

“Esperamos que toda esta investigación sirva para que nuestro fármaco llegue finalmente a los pacientes”, declara Soucek, que desarrolló el Omomyc con la colaboración de Marie-Eve Baulieu para que pudiera acceder al núcleo de las células. En una conversación con La Vanguardia en 2019, tras presentar sus primeros resultados positivos en ratones, la investigadora recordó que “todo el mundo decía que inhibir MYC era imposible. Allí donde otros veían un problema imposible, yo veía dificultades técnicas que esperaba que se pudieran resolver”.

Referencias

SOUCEK, MARIE-EVE BAULIEU desarrollaron omomyc para que pudiera acceder al núcleo de las células.

LAURA SOUCEK Y ELENA GARRALDA, en el instituto de oncología de vall d’hebron (vhio)

MIQUEL GONZÁLEZ / shooting / colaboradores

JOSEP CORBELLA Barcelona 26/10/2022 06:44actualizado a 26/10/2022 10:36

BOGENHAUSEN DE Múnich andreas nerlich openmind el paleopatólogo del hospital académico

 

CAR-T TRATAMIENTO DEL CÁNCER CON CÉLULAS MANIPULADA

CAR-T TRATAMIENTO DEL CÁNCER CON CÉLULAS MANIPULADAS

La inmunidad celular es aquella realizada mediante el ataque directo de las células inmunes contra los agentes externos al organismo. La inmunidad humoral es el principal mecanismo de defensa contra los microorganismos extracelulares y sus toxinas, y se realiza mediante anticuerpos que atacan a los antígenos de las células extrañas al organismo.

Un CART consiste en rediseñar las células “buenas” del organismo de un paciente para combatir un cáncer. Pero no cualquier célula. No. Las seleccionadas son los linfocitos T.

inmunoterapia CAR linfocito T

Un linfocito T es una célula de nuestro propio organismo, el de todos, pacientes y personas sanas. Los linfocitos son unidades fundamentales de nuestro cuerpo. Son creados por nuestra médula ósea, una substancia que se encuentra dentro de nuestros huesos y contiene las células madre de la sangre que, a posteriori, se convertirán en glóbulos rojos, glóbulos blancos o plaquetas.

Los glóbulos blancos (o leucocitos) son parte del sistema inmunitario de nuestro cuerpo. Nos ayudan a combatir infecciones, elementos extraños (microorganismos, células tumorales o antígenos en general), etc…. Hay 3 grandes tipos de glóbulos blancos: los granulocitos (neutrófilos, eosinófilos y basófilos), los monocitos y los linfocitos (células T y células B).

Los linfocitos T, que se desarrollan en el timo, participan en la respuesta inmunitaria celular** de nuestro organismo; y los linfocitos B, que se desarrollan en la médula ósea y luego migran a diferentes tejidos linfáticos, son los encargados de la respuesta humoral** transformándose en plasmocitos que producen anticuerpos.

Los linfocitos T tienen un receptor especial en la membrana de las células que es específico de ellos y se llama, en inglés, T cell receptor.

Cada año, más de 6.400 personas son diagnosticadas de leucemia en España, es el cáncer infantil más frecuente (un 30% de las neoplasias en niños).

Además de la leucemia, quizá el cáncer de la sangre más conocido, muchas personas también son diagnosticadas de linfomas, mieloma múltiple, síndromes mielodisplásicos, entre muchos otros

Una persona que padece un cáncer de la sangre como una leucemia o un linfoma, por ejemplo, tiene una médula ósea que no está funcionando correctamente. Por causas todavía desconocidas, las células madre de la sangre empiezan a fabricar en cantidades excesivas una línea celular, por ejemplo, los linfocitos. Estos linfocitos son inmaduros (linfoblastos), se multiplican rápidamente y desplazan a las células normales de la médula ósea, el tejido blando del centro de los huesos dónde se forman las células sanguíneas.

Lo que pretende la quimioterapia es administrar una serie de fármacos muy potentes y que estos erradiquen completamente las células cancerígenas (y, desgraciadamente, también las sanas). Cuando los tratamientos de quimioterapia no son suficientes, bien porque la enfermedad no remite, bien porque reaparece, en algunos cánceres de la sangre, los hematólogos pueden plantear un trasplante de células madre de la sangre (médula ósea, sangre periférica o sangre de cordón umbilical).

Básicamente, un trasplante de células madre de la sangre (llamado, médicamente, trasplante de progenitores hematopoyéticos) consiste en “substituir” la médula ósea dañada del paciente por una nueva. En un trasplante autólogo, se tratan las propias células madre de la sangre del paciente y se le vuelven a infundir y, en un trasplante alogénico, éstas se substituyen por las células de un donante sano. Muchos cánceres de la sangre pueden requerir un trasplante de células madre: las leucemias agudas, los linfomas, el mieloma múltiple o los síndromes mielodisplásicos, entre otros.

¿Qué ocurrió en abril de 2012?

carl June inmunoterapia CART

Tenemos que remontarnos un poco más atrás. El Dr. Carl June es un inmunólogo y oncólogo americano que trabaja en la Universidad de Pensilvania (Filadelfia, Estados Unidos).

El Dr. June empezó su carrera como investigador centrándose sobre todo en el virus de inmunodeficiencia humana (VIH). Su idea era estimular el propio sistema inmunitario de estos pacientes para luchar contra el SIDA. Pero sus prioridades cambiaron cuando a su mujer le diagnosticaron un cáncer de ovario en 1996, cuando tenía 41 años. June intentó desarrollar entonces una inmunoterapia contra el cáncer, pero no logró convencer a ninguna compañía de que invirtiera en el proyecto. Cuando su mujer murió en el 2001, June decidió dedicarse a tiempo completo a la inmunoterapia del cáncer.

¿Qué es un CART?

Las células tumorales expresan unos receptores en sus membranas. En cada subtipo de la enfermedad, estas células, y, por lo tanto, los receptores, son distintos y se denominan con “nombres” diferentes. Por ejemplo, los receptores de las células de una leucemia linfoblástica aguda o de algunos linfomas no Hodgkin de tipo B como el linfoma no Hodgkin de células B grandes, se llaman CD19; los del linfoma de Hodgkin o de algunos tipos de linfomas no Hodgkin de tipo T, CD30; o los del mieloma múltiple, CD38. Estos “CD” (cúmulo de diferenciación) son antígenos celulares que se expresan en las membranas de las células tumorales y están formados por cadenas de aminoácidos.

Pero, volvamos a los linfocitos T. Como ya hemos dicho anteriormente, estos están “entrenados” para matar células extrañas del organismo. Podríamos decir que son “naturalmente asesinos”. Pero, en una analogía bélica poco adecuada pero muy descriptiva, podríamos decir que están diseñados biológicamente para “matar moscas a cañonazos”. Erradican muchas células extrañas que se encuentran, pero no todas y no específicamente. Un CART podría definirse, con nuestra analogía, como un calibrado de estas células. Sería coger estos linfocitos T que ya tiene el paciente y saben destruir células, y diseñarlos concretamente para acabar con los receptores concretos de las células tumorales: CD19, CD30, CD38…. según la enfermedad que se esté tratando.

¿Cómo se administra un CART?

Se extraen los linfocitos T del propio paciente a tratar. Pongamos por caso que es un paciente de leucemia linfoblástica aguda de tipo B (ya hemos comentado anteriormente que las células tumorales de este paciente expresan unos antígenos llamados CD19).

Mediante un lentivirus, un virus cuyo periodo de incubación es muy largo, los inmunólogos infectaran a estos linfocitos T con un virus perpetuo anti-CD19 y los multiplicaran en el laboratorio.

Tienen los parámetros ambientales estrictamente controlados: partículas en aire, temperatura, humedad, flujo de aire, presión interior del aire, iluminación…

A posteriori, tras un ciclo de acondicionamiento con quimioterapia, se infundirán estas células anti-CD19 de nuevo en el paciente. De esta manera, en el paciente quedarán unos linfocitos T perpetuos cargados con “armamento anti-CD19” que se llamarán CART anti-CD19.

inmunoterapia CART 3

El primer CART que se llevó a cabo en Estados Unidos fue el CART anti-D19 para leucemia linfoblástica aguda de tipo B infantil, el que se administró a Emily Whitehead. Este ensayo clínico fue posible gracias a una gran farmacéutica, Novartis. Hasta 2016, los tratamientos de inmunoterapia CART que se realizaron en Estados Unidos fueron ensayos clínicos de grandes empresas farmacéuticas. En 2016, Novartis inició el primer ensayo clínico de esta inmunoterapia en algunos hospitales pediátricos de Europa. En nuestro país, los primeros CARTs se realizaron como ensayo clínico en el Hospital Sant Joan de Déu de Barcelona.

Los resultados de estos primeros ensayos clínicos fueron espectaculares y completamente sorprendentes para el mundo de la medicina en general y de la hematología en particular. El 80% de los pacientes estaban libres de la enfermedad un año después de someterse al CART. Es importante destacar que todos estos pacientes eran niños o personas muy jóvenes, todos menores de 25 años, que no habían respondido a ninguno de los tratamientos previos, incluidos trasplantes de células madre de la sangre.

A pesar de ello, la coyuntura de estos ensayos clínicos es complicada. La mayoría de tratamientos  CART se suministran a través de una farmacéutica y, por lo tanto, son ensayos clínicos privados, y su coste es muy alto.

En paralelo a estos descubrimientos, algunos grupos de hematólogos e inmunólogos decidieron avanzar para crear unos CARTs llamados “académicos”. Son CARTs impulsados por un hospital universitario, en nuestro país, público, y, por lo tanto, con un coste mucho más asequible. El Hospital Clínic de Barcelona, de la mano del Dr. Álvaro Urbano-Ispizua y del inmunólogo, Dr. Manuel Juan, fueron los primeros en tener a punto un CART académico anti-CD19. Una vez logrados los permisos de la Agencia Española del Medicamento, se empezó el primer ensayo clínico con CART académico anti CD19 en el Hospital Clínic, para adultos, y en el Hospital Sant Joan de Déu para niños. Todos los receptores tenían que ser pacientes con leucemia linfoblástica aguda de tipo B y menores de 25 años. Los resultados también fueron los esperados. En paralelo, en varios hospitales también se continuaron los ensayos clínicos del CART anti-CD19 comercial de la industria farmacéutica).

A pesar de que los primeros resultados fueron apabullantes (>80% de pacientes libres de la enfermedad), los científicos pronto vieron que había que perfeccionar algunos aspectos de esta nueva terapia. En primer lugar, se dieron cuenta que la administración del CART provocaba en el paciente una reacción grave llamada “síndrome de liberación de citoquinas”. El síndrome de liberación de citocinas se presenta por una liberación masiva y rápida en la sangre de las células afectadas por la inmunoterapia. Las citocinas son sustancias que tienen muchas acciones diferentes en el cuerpo. Los signos y síntomas del síndrome de liberación de citocinas incluyen fiebre, náuseas, dolor de cabeza, sarpullidos, latidos cardíacos rápidos, presión arterial baja y dificultad para respirar. La mayoría de los pacientes tienen una reacción leve, pero, a veces, la reacción es grave o pone en peligro la vida. Por ello, se crearon equipos multidisciplinarios para tratar a estos pacientes y, hoy en día, es una complicación que se ha sabido manejar positivamente.

Por otra parte, se vio como algunos pacientes “perdían” los CARTs con el paso del tiempo, perdiendo por supuesto también la reacción inmunológica contra las células tumorales. A pesar de ello, hoy en día el 40-50% de los pacientes que se someten a un CART anti-CD19 siguen libres de la enfermedad pasado un año. Un resultado a mejorar, por supuesto, pero de momento, exitoso.

Actualmente, en nuestro país conviven los ensayos clínicos de CART comerciales y los académicos. No solamente se han desarrollado inmunoterapias CART anti-CD19 para leucemia linfoblástica aguda de tipo B sino también para linfomas no Hodgkin de tipo B como el linfoma difuso de células grandes, por ejemplo. Están ya en curso ensayos clínicos con inmunoterapia anti-CD30 para linfoma de Hodgkin y linfomas no Hodgkin de tipo T y, se están estudiando esta terapia para otras dolencias como la leucemia mieloide aguda. También hay centros españoles que han iniciado ensayos clínicos, tanto académicos como comerciales, con inmunoterapia CART para mieloma múltiple.

La inmunoterapia CART es el futuro de la curación de muchos cánceres de la sangre. En un futuro se espera poder desarrollar estrategias de tratamiento CART también para pacientes con otras neoplasias hematológicas o, incluso, tumores sólidos. El campo de aplicación de esta terapia es muy amplio.

Pero la inmunoterapia CART no es el futuro por si sola. De hecho, hoy en día se están realizando tratamientos de CART incluso a pacientes que se no consigue hacer remitir la enfermedad para conseguir erradicarla y, a posteriori, realizarles un trasplante de células madre de la sangre. La inmunoterapia CART es una nueva arma que deberá complementar y regularse junto con el arsenal terapéutico ya existente.

 

Carl H. June, inmunólogo y pionero en la terapia con células CAR-T confía en que este tipo de tratamientos llegue también a otras patologías no oncológicas.

En 1999, June empezó a aplicar, ya en la Universidad de Pensilvania, sus conocimientos sobre el VIH para intentar estimular al sistema inmune frente a la enfermedad. Así surgió un programa de entrenamiento para que ciertas células inmunitarias, los linfocitos T, atacaran con mayor precisión y potencia a las células tumorales. Mediante ingeniería genética modificaron linfocitos T para que expresaran un marcador, un receptor antigénico quimérico (CAR, en su acrónimo inglés). “Como sabía mucho sobre el VIH, fuimos los únicos que utilizamos este tipo de virus [modificado para que no cause enfermedad] para colocar la molécula CAR en las células T y resulta que era una buena forma. Tuve suerte. Haberme formado en diferentes disciplinas resultó ser una ventaja muy grande y algo que nunca hubiera planeado. Fue un accidente causado por la guerra”, resume con sencillez.

La terapia con células CAR-T de June cosechó resultados sorprendentes en sus primeros ensayos iniciados en 2010 con pacientes afectados por leucemia linfocítica crónica refractaria y recidivante, incluida poco después una niña de seis años que ahora es una adolescente sin rastro de la enfermedad. Hoy, hay varias compañías farmacéuticas que comercializan células CAR-T para diversas indicaciones, todas de cáncer hematológico. En España, un total de 15 hospitales están autorizados para administrarlas a los pacientes, mediante un proceso que implica extraer los linfocitos del paciente, modificarlos genéticamente en un laboratorio e introducirlos de nuevo en el enfermo para que ataquen a las células enfermas.

Deben superarse otras barreras para que esta terapia pueda funcionar en otros tumores?
Son mas difíciles que en el cáncer hematológico, porque el cáncer sólido tiene más formas de apagar el sistema inmunológico; cuenta con muros, algunos hechos con tejido cicatricial, para evitar que los invasores entren. En el cáncer de la sangre, las células CAR-T no tienen que atravesar una pared para llegar hasta la célula tumoral. Por esto estamos trabajando en diversos enfoques, como combinar las células CAR-T con un virus capaz de infectar al tumor para ayudar a los linfocitos a entrar. De hecho, esta investigación la llevamos a cabo con un equipo de Barcelona, con Ramón Alemany, quien desarrolló el virus oncolítico, y Sònia Guedan, que estuvo haciendo un posgrado en mi laboratorio de Pensilvania. Tenemos un ensayo clínico abierto en cáncer de ovario. También vamos a ensayar el cáncer de páncreas con esta estrategia combinada. Y creo que habrá muchos más estudios en esta línea. Es una forma de derribar los muros, que parece muy prometedora. Hay muchas investigaciones aquí en España y en todo el mundo para tratar de hacer que funcione en el cáncer sólido. Y está funcionando en ratones y está empezando a funcionar en algunos ensayos en humanos, por ejemplo, se han visto datos emocionantes en un reciente ensayo sobre cáncer cerebral infantil en Stanford. Hay mil ensayos ahora, sin embargo, es importante recordar que estamos en el campo de la investigación. De momento, la terapia CAR-T solo está aprobada para el cáncer de sangre.

«Las CAR-T está empezando a funcionar, en el campo de la investigación, en tumores como el de páncreas, cerebral y de ovario»

También se está trabajando en otras enfermedades diferentes al cáncer, como el lupus, .

Las células CAR-T aplicadas al cáncer activan el sistema inmunitario, pero también puede ser interesante desactivarlo, por ejemplo, en el caso de las enfermedades autoinmunes o para evitar el rechazo en un trasplante de riñón. Si se pudiera diseñar una célula que desactivara específicamente la respuesta contra el órgano trasplantado, tendríamos un tratamiento más seguro para el paciente, que no contraería ni siquiera infecciones. En esa dirección se está investigando mucho con las llamadas células T reguladoras (Tregs). Acabamos de empezar un ensayo en la Universidad de Pensilvania con este tratamiento. En el lupus que menciona, se ha tratado ya a algunos pacientes en un ensayo, en la Universidad de Erlangen, en Alemania, con resultados emocionantes.

También hemos publicado datos en ratones donde hemos tratado la fibrosis cardíaca. Y hay muchas enfermedades en las que se generan cicatrices, por ejemplo, en los pulmones.

Vamos a ver cómo se utilizan las células manipuladas para muchos tipos de enfermedades aparte del cáncer. Todavía es pronto, pero creo que podremos tratar con células modificadas incluso patologías como la esclerosis múltiple o la enfermedad de Alzheimer, donde se acumulan proteínas en el cerebro. Casi todas las enfermedades tienen algún tipo de componente de inflamación, y podemos intentar dirigir células modificadas para que actúen sobre las moléculas que causan el daño.

P. Volviendo a las actuales células CAR-T. Es cierto que están añadiendo vida a un grupo de pacientes, pero no siempre funcionan, ¿cómo mejorarlas?
R. Hay varias estrategias para aumentar su eficacia. Por un lado, están las combinaciones, como la de los virus oncolíticos que comentaba para alcanzar mejor a los tumores. También está la idea de manipular a la célula T para que sea más potente, convertirla en un especie súper célula T, mediante la modificación de sus genes.

Otra categoría de investigación, es conseguir que la célula CAR-T luche contra el microambiente del tumor, que es lo que lo protege y favorece su crecimiento.

Y también se avanza en conseguir que los linfocitos T tengan el mismo efecto que los anticuerpos que inhiben los llamados puntos de control (checkpoint), la inmunoterapia que se emplea ahora en algunos tipos de cáncer. Esta es un área muy prometedora, pues se obtendrían una célula CAR-T que de forma local, una vez en el tumor, secrete los anticuerpos. Una de mis colaboradoras, Marcela Maus, que ahora está en Harvard, trabaja con células CAR-T que segregan BiTE [del inglés, anticuerpo biespecífico de células T], un anticuerpo que tiene dos especificidades, es muy complejo. Se une a una célula T y a la célula tumoral. De esta forma, la célula CAR-T cuenta con su propio anticuerpo dirigido al tumor y aporta ese anticuerpo biespecífico que puede dirigirse al microambiente del tumor. Como ve, hay mucha investigación y muy esperanzadora en este campo.

Un potencial por explorar en las CAR: fibrosis cardíaca, lupus y hepatitis B

La Red Española de Terapias Avanzadas se hace más fuerte en España

Las CAR-T se consolidan en linfoma, leucemia y mieloma múltiple

P. Además, existe la posibilidad de utilizar otras células diferentes los linfocitos T.
R. Sí, como las células asesinas naturales (CAR-NK) y también los hay macrófagos, que llamamos CAR-Ms. Tenemos un ensayo en la Universidad de Pensilvania con macrófagos, que literalmente se comen las células tumorales. Mientras que las células T hacen agujeros en la célula tumoral provocando que muera, los macrófagos las eliminan por fagocitosis. Esperamos que, dado que acaban de forma diferente con el tumor, puedan ser dos aproximaciones sinérgicas.

Un problema de estas terapias es su alto coste, que también dificulta el acceso a todos los pacientes que lo necesiten, la logística de la fabricación es muy complicada y se necesita a profesionales altamente cualificados, pero hay ejemplos que nos indican que esto no tiene que ser siempre así. El caso de los coches, por ejemplo, con Henry Ford, se fabricaban con trabajadores en una línea de montaje y ahora el 80% o más de un coche está fabricado por robots. Tendrá que llegar la automatización de la fabricación celular, lo que reducirá su coste drásticamente.

Y otro forma de abordar el problema también será utilizar en lugar de las propias células T del paciente, células ya listas, cultivadas en grandes lotes y disponibles para cualquier enfermo. Esto también haría más accesible.

Esto es una cuestión de ingeniería, no hace falta ningún descubrimiento científico. Es como aprender a hacer teléfonos móviles mejores y más baratos. Ahora estamos en esa etapa de conseguir que la fabricación de la terapia celular se abarate y terminará haciéndose directamente en el hospital, sin esperar tantos días para su producción. Ahora ya sabe que extraen la sangre del paciente, la envían a un centro de fabricación, cuando están listas, congelan las células y las envían de vuelta, para que el médico las infunda en el paciente. Todo eso se hará en un futuro en el lugar donde está el paciente, de forma más sencillo y mucho menos costosa. ►

¿Qué hospitales administran CARTs en España y cómo lo hacen?

Para explicar qué hospitales administran CARTs y si estos son académicos o comerciales es necesario entender por qué diferentes fases para la aprobación de un ensayo clínico en nuestro país.

Fases IMPRESCINDIBLES (en la práctica y en la legalidad) para producir un tratamiento eficaz

fases ensayo clínico

Como se puede leer en la gráfica adjunta, después de los estudios celulares y los estudios en modelos animales, un tratamiento entra en una fase de ensayo clínico denominada Fase I. Para a ello, el equipo debe haber demostrado la efectividad del nuevo tratamiento con 3 pruebas exitosas en modelos animales en condiciones GMP*, haber presentado toda la documentación a la Agencia Española del Medicamento y haber recibido su verificación y autorización. Solo entonces, se podrá llevar a cabo una prueba en unos 10-30 pacientes debidamente seleccionados.

Una vez analizados estos resultados en estos pocos pacientes, se continua o no el ensayo en Fase 2, 3, etc… Son procedimientos muy costosos y complicados.

En el caso del CART anti-CD19, se llevaron a cabo en España todas las pruebas pertinentes y, en diciembre de 2018, la Ministra de Sanidad, Consumo y Bienestar Social, María Luisa Carcedo, anunció la aprobación de la financiación de la primera terapia CART de la industria farmacéutica privada en el Sistema Nacional de Salud (SNS). Se trataba del CART anti-CD19 de Novartis (Kymriah®), indicado para tratar la leucemia linfoblástica aguda (LLA) de células B refractaria, en recaída postrasplante de médula ósea o en segunda o posterior recaída en pacientes pediátricos y adultos jóvenes de hasta 25 años de edad y para la indicación de linfoma B difuso de célula grande (LBDCG), en recaída o refractario tras dos o más líneas de tratamiento sistémico en pacientes adultos. La ministra realizó este anuncio junto a la presentación del Libro blanco de la terapia celular en España, de la Red de Terapia Celular Española del Instituto de Salud Carlos III.

¿Cuál es el criterio para la selección de pacientes para someterse a una inmunoterapia CART?

Según el Ministerio de Sanidad, en el caso de los pacientes de leucemia linfoblástica aguda B, se consideran pacientes candidatos a iniciar un tratamiento de inmunoterapia CAR-T anti CD19 los siguientes pacientes:

Pacientes pediátricos y adultos jóvenes hasta 25 años.

Pacientes de leucemia linfoblástica aguda B (LLA-B) CD19+ refractaria o en recaída:

– Segunda o posterior recaída de la enfermedad tras el tratamiento con dosis convencionales de quimioterapia/terapia de anticuerpo monoclonal.

– Cualquier recaída que ocurra tras un trasplante alogénico de progenitores hematopoyéticos (alo TPH o trasplante procedente de un donante).

– Enfermedad refractaria primaria que no logra alcanzar respuesta completa tras la segunda línea de quimioterapia estándar.

– Enfermedad refractaria secundaria definida como no lograr una respuesta completa después de 1 ciclo de quimioterapia estándar en casos de LLA en recaída.

– Pacientes en recaída que no son candidatos por criterio clínico a un aloTPH (trasplante de donante), pero que están en un estado funcional adecuado para el tratamiento con inmunoterapia CAR-T.

Según el Ministerio de Sanidad, en el caso de los pacientes de linfoma difuso de células B grandes, se consideran pacientes candidatos a iniciar un tratamiento de inmunoterapia CAR-T anti CD19 los pacientes:

Pacientes adultos (mayores de 18 años).

Pacientes de linfoma difuso de células B grandes (LDCBG), linfoma folicular transformado a LDCBG o linfoma primario del mediastino.

Pacientes con la enfermedad en recaída o refractaria tras al menos 2 líneas de tratamiento sistémico, definida por uno de los criterios que vienen a continuación, y que o bien el paciente no hubiera respondido al trasplante autólogo o bien no fuera candidato por criterios clínicos:

– Pacientes con LBDCG que ha recibido 2 o más líneas de terapia sistémica y recae después de la ultima línea o es refractario a la ultima línea de terapia sistémica.

-Pacientes con linfoma folicular transformado que ha recibido 2 o mas líneas de terapia sistémica desde el diagnóstico de transformación y recae después de la ultima línea o es refractario a la ultima línea de terapia sistémica.

Breve Bibliografia

Carl H.June es director del Centro de Inmunoterapias Celulares de la Universidad de Pensilvania.

Foto: ÁNGEL NAVARRETE.

Sonia Moreno. Madrid Vie, 09/09/2022 – 17:47

 

LA VACUNA DE LA TUBERCULOSIS EN CÁNCER DE VEJIGA DONDE FRACASA LA ACTUAL BCG

LA VACUNA DE LA TUBERCULOSIS EN CÁNCER DE VEJIGA DONDE FRACASA LA ACTUAL BCG

En modelo experimental, el grupo de la Unizar muestra que su vacuna contra la tuberculosis es superior a la BCG en cáncer de vejiga. Carcinoma Urotelial de Ureterocele: Manejo de una infrecuente forma de presentación

El uso de la inmunoterapia en el cáncer no es una estrategia nueva, como pueda parecer por el reciente desarrollo de los fármacos oncológicos que bloquean puntos de control inmunitario (inhibidores de checkpoint).

Entre las estrategias pioneras para espolear al sistema inmune como una potente herramienta de lucha contra el cáncer se encuentran las vacunas, estimuladoras inmunológicas por excelencia. Y, de hecho, la primera  inmunoterapia contra el cáncer aprobada por la agencia del medicamento estadounidense FDA es la vacuna contra la tuberculosis BCG. Administrada por vía intravesical, es desde hace más de cuarenta años el tratamiento de primera línea en el cáncer de vejiga no músculo invasivo (Nmibc, en sus siglas inglesas) de alto riesgo.

Sin embargo, la vacuna no es eficaz en aproximadamente el 40% de los pacientes, y se estima que la mayoría de los que sufren episodios de recurrencia después del tratamiento con BCG progresan a tumor T2 (con invasión muscular); en ese punto de la enfermedad, la cistectomía radical es prácticamente la única opción terapéutica.

En un estudio coordinado por el investigador Nacho Aguiló, del Grupo de Genética de Micobacterias del Departamento de Microbiología y Medicina Preventiva que dirige Carlos Martín en la Universidad de Zaragoza, ya se ha demostrado la capacidad de la candidata vacunal contra la tuberculosis MTBVAC como agente inmunoterápico para el cáncer de vejiga en un modelo experimental.

LEn modelo experimental, el grupo de la Unizar muestra que su vacuna contra la tuberculosis es superior a la BCG en cáncer de vejiga.

El uso de la inmunoterapia en el cáncer no es una estrategia nueva, como pueda parecer por el reciente desarrollo de los fármacos oncológicos que bloquean puntos de control inmunitario (inhibidores de checkpoint).

Entre las estrategias pioneras para espolear al sistema inmune como una potente herramienta de lucha contra el cáncer se encuentran las vacunas, estimuladoras inmunológicas por excelencia. Y, de hecho, la primera  inmunoterapia contra el cáncer aprobada por la agencia del medicamento estadounidense FDA es la vacuna contra la tuberculosis BCG. Administrada por vía intravesical, es desde hace más de cuarenta años el tratamiento de primera línea en el cáncer de vejiga no músculo invasivo (Nmibc, en sus siglas inglesas) de alto riesgo.

Sin embargo, la vacuna no es eficaz en aproximadamente el 40% de los pacientes, y se estima que la mayoría de los que sufren episodios de recurrencia después del tratamiento con BCG progresan a tumor T2 (con invasión muscular); en ese punto de la enfermedad, la cistectomía radical es prácticamente la única opción terapéutica.

En un estudio coordinado por el investigador Nacho Aguiló, del Grupo de Genética de Micobacterias del Departamento de Microbiología y Medicina Preventiva que dirige Carlos Martín en la Universidad de Zaragoza, ya se ha demostrado la capacidad de la candidata vacunal contra la tuberculosis MTBVAC como agente inmunoterápico para el cáncer de vejiga en un modelo experimental.

MTBVAC es la candidata vacunal para la TB construida en la Universidad de Zaragoza (Unizar) por este equipo científico y que tras más dQue hacer ante la escasez de BCG para el tratamiento del cancer de vejiga? | Dr. Luciano Nuñeze dos décadas de investigación se encuentra de lleno en la fase III de ensayo clínico.

Al igual que la centenaria BCG, utiliza una forma viva atenuada de la micobacteria causante de la enfermedad (en concreto el patógeno humano Mycobacterium tuberculosis), un hecho que podría ser clave para obtener efectos beneficiosos más allá de la prevención de la TB, y que estos científicos exploran, entre otras enfermedades, en el cáncer de vejiga.

Ahora estos investigadores dan un salto “cualitativo” con un nuevo estudio que se publica hoy lunes en Journal for ImmunoTherapy of Cancer, la revista de mayor impacto en la inmunoterapia de cáncer. Así lo considera su autor principal, Nacho Aguiló, quien destaca a DM que “vamos un paso más allá en nuestra investigación, pues nos hemos centrado en uno de los problemas reales que se producen con el tratamiento de BCG y el cáncer de vejiga: hay un grupo de pacientes, entre el 30-40%, que no responden a esta vacuna, y en la mayoría de esos casos, para evitar recidivas la opción es la cistectomía, con todo lo que ello implica de morbilidad posoperatoria y pérdida de calidad de vida”, recuerda el científico.

En 2020, un inhibidor de checkpoint, el anti PD-1 pembrolizumab recibió la aprobación por parte de la FDA para administrarse en los no respondedores a la primera línea terapéutica con BCG. El fármaco exhibe una eficacia modesta (20% de los pacientes tratados en remisión al año). En esos pacientes también se recurre al quimioterápico valrubicina, con una tasa de respuesta aún más modesta (16% sin enfermedad durante doce meses), lo que justifica la necesidad de encontrar mejores tratamientos antes de optar por la extirpación.

Con ese objetivo, los investigadores de la Unizar han puesto a punto un modelo de ratón de cáncer de vejiga resistente al tratamiento con BCG. Aquí han comprobado que la candidata vacunal MTBVAC es un estimulador del sistema inmunológico superior a BCG. En este modelo experimental de tumor de vejiga, la BCG no funcionaba en ningún caso, mientras que en MTBVAC lo hacía en un 60-70% de los animales.

“Estos datos nos hacen concluir que nuestra vacuna puede ser una alternativa viable para tratar este tipo de tumores, que no tienen cura en la actualidad más allá de la amputación de la vejiga. Además, a tenor de estos resultados no descartamos que la administración de MTBVAC en primera línea, en lugar de BCG, logre reducir el porcentaje de fracasos terapéuticos”.

MTBVAC combinado con anti PD-1

Otro hallazgo relevante del estudio es que la combinación del anticuerpo monoclonal pembrolizumab con MTBVAC consigue el rechazo del tumor en el 100% de los animales. “Repetimos el experimento tres veces, porque no nos creíamos los resultados”, comenta el científico.

Mientras MTBVAC continúa su andadura para convertirse en la sustituta de la BCG en la prevención de la TB, estos científicos exploran otros potenciales terapéuticos, además de en cáncer de vejiga, también como tratamiento en asma. Aguiló destaca el papel de Biofabri (Grupo Zendal) en el camino hacia el desarrollo clínico de estas investigaciones.

“Los cimientos están puestos: cuanto más robusto sea el desarrollo preclínico, más fácilmente se obtienen los permisos necesarios de las autoridades reguladoras para avanzar hacia el estudio clínico. Por eso ahora queremos reproducir estos hallazgos en otros modelos experimentales de cáncer de vejiga y, de forma especial, recabar más datos de seguridad de la MTBVAC en esta ruta de administración y con dosis múltiples”.

Cuentan con una gran ventaja y es toda la investigación realizada a lo largo de lustros de comparación de MTBVAC con la vacuna BCG. La investigación que este grupo lleva desplegando es una muestra de la importancia que tiene el muchas veces sordo trabajo de laboratorio.

Después de leer este artículo me he acordado de mi querido amigo Miguel un médico eminente y bondadoso qué afectado por un tumor de vejiga recibió como tratamiento la vacuna BCG intravesical.

Fue un éxito al principio, pero un par de años más tarde empieza a tener una cicatriz en toda la vejiga que le impiden a los uréteres drenar la orina a esta cavidad

Los problemas se fueron incrementando hasta conectarle unos catéteres a la vejiga que perforaban la cavidad peritoneal y se conectaban con un reservorio colocado en la espalda, ya no volvió a orinar por vías fisiológicas y periódicamente vaciaba el reservorio de la espalda terriblemente molesto pero que él con su riqueza espiritual lo soportaba perfectamente.

Con una mala calidad de vida soporto esto treintaaños, y a partir de entonces empieza tener cuadro general de afectación y le diagnostican hasta 30 metástasis en toda su biología y unos días más tarde muere con una dignidad envidiable.

Es sorprendente el ingenio de los investigadores convierten una vacuna anti microbiana nunca demasiado eficaz en un medicamento antitumoral que posiblemente no está totalmente perfeccionado pero tiene futuro.

Es admirable el ingenio de estos investigadores que siguen y siguen y van perfeccionando los beneficios de esta terapia.

Mi charla con mi amigo Miguel ya muy lesionado y con su reservorio en la espalda fueron para mí gratificantes no por el efecto médico sino por la dignidad con que soportaba sus penurias.

Nuestros tiempos que están llenos de maldades, están sin embargo conduciéndonos a un desarrollo de terapia muy eficaces sobre todo contra los malditos tumores que tanto daño nos hacen y esto se debe a la tenacidad de los investigadores que le han cogido el truco a la inmunidad.

Nacho Aguiló, Eduardo Moreo, Ana Belén Gómez, Carlos Martín, Ana Picó y Santiago Uranga, de la Universidad de Zaragoza.

Sonia Moreno. Madrid Lun, 04/07/2022 – 08:00

MTBVAC es la candidata vacunal para la TB construida en la Universidad de Zaragoza (Unizar) por este equipo científico y que tras más de dos décadas de investigación se encuentra de lleno en la fase III de ensayo clínico.

Al igual que la centenaria BCG, utiliza una forma viva atenuada de la micobacteria causante de la enfermedad (en concreto el patógeno humano Mycobacterium tuberculosis), un hecho que podría ser clave para obtener efectos beneficiosos más allá de la prevención de la TB, y que estos científicos exploran, entre otras enfermedades, en el cáncer de vejiga.

Ahora estos investigadores dan un salto “cualitativo” con un nuevo estudio que se publica hoy lunes en Journal for ImmunoTherapy of Cancer, la revista de mayor impacto en la inmunoterapia de cáncer. Así lo considera su autor principal, Nacho Aguiló, quien destaca a DM que “vamos un paso más allá en nuestra investigación, pues nos hemos centrado en uno de los problemas reales que se producen con el tratamiento de BCG y el cáncer de vejiga: hay un grupo de pacientes, entre el 30-40%, que no responden a esta vacuna, y en la mayoría de esos casos, para evitar recidivas la opción es la cistectomía, con todo lo que ello implica de morbilidad posoperatoria y pérdida de calidad de vida”, recuerda el científico.

En 2020, un inhibidor de checkpoint, el anti PD-1 pembrolizumab recibió la aprobación por parte de la FDA para administrarse en los no respondedores a la primera línea terapéutica con BCG. El fármaco exhibe una eficacia modesta (20% de los pacientes tratados en remisión al año). En esos pacientes también se recurre al quimioterápico valrubicina, con una tasa de respuesta aún más modesta (16% sin enfermedad durante doce meses), lo que justifica la necesidad de encontrar mejores tratamientos antes de optar por la extirpación.

Con ese objetivo, los investigadores de la Unizar han puesto a punto un modelo de ratón de cáncer de vejiga resistente al tratamiento con BCG. Aquí han comprobado que la candidata vacunal MTBVAC es un estimulador del sistema inmunológico superior a BCG. En este modelo experimental de tumor de vejiga, la BCG no funcionaba en ningún caso, mientras que en MTBVAC lo hacía en un 60-70% de los animales.

“Estos datos nos hacen concluir que nuestra vacuna puede ser una alternativa viable para tratar este tipo de tumores, que no tienen cura en la actualidad más allá de la amputación de la vejiga. Además, a tenor de estos resultados no descartamos que la administración de MTBVAC en primera línea, en lugar de BCG, logre reducir el porcentaje de fracasos terapéuticos”.

MTBVAC combinado con anti PD-1

Otro hallazgo relevante del estudio es que la combinación del anticuerpo monoclonal pembrolizumab con MTBVAC consigue el rechazo del tumor en el 100% de los animales. “Repetimos el experimento tres veces, porque no nos creíamos los resultados”, comenta el científico.

Mientras MTBVAC continúa su andadura para convertirse en la sustituta de la BCG en la prevención de la TB, estos científicos exploran otros potenciales terapéuticos, además de en cáncer de vejiga, también como tratamiento en asma. Aguiló destaca el papel de Biofabri (Grupo Zendal) en el camino hacia el desarrollo clínico de estas investigaciones.

“Los cimientos están puestos: cuanto más robusto sea el desarrollo preclínico, más fácilmente se obtienen los permisos necesarios de las autoridades reguladoras para avanzar hacia el estudio clínico. Por eso ahora queremos reproducir estos hallazgos en otros modelos experimentales de cáncer de vejiga y, de forma especial, recabar más datos de seguridad de la MTBVAC en esta ruta de administración y con dosis múltiples”.

Cuentan con una gran ventaja y es toda la investigación realizada a lo largo de lustros de comparación de MTBVAC con la vacuna BCG. La investigación que este grupo lleva desplegando es una muestra de la importancia que tiene el muchas veces sordo trabajo de laboratorio.

Después de leer este artículo me he acordado de mi querido amigo Miguel un médico eminente y bondadoso qué afectado por un tumor de vejiga recibió como tratamiento la vacuna BCG intravesical.

Fue un éxito al principio, pero un par de años más tarde empieza a tener una cicatriz en toda la vejiga que le impiden a los uréteres drenar la orina a esta cavidad

Los problemas se fueron incrementando hasta conectarle unos catéteres a la vejiga que perforaban la cavidad peritoneal y se conectaban con un reservorio colocado en la espalda, ya no volvió a orinar por vías fisiológicas y periódicamente vaciaba el reservorio de la espalda terriblemente molesto pero que él con su riqueza espiritual lo soportaba perfectamente.

Con una mala calidad de vida soporto esto treintaaños, y a partir de entonces empieza tener cuadro general de afectación y le diagnostican hasta 30 metástasis en toda su biología y unos días más tarde muere con una dignidad envidiable.

Es sorprendente el ingenio de los investigadores convierten una vacuna anti microbiana nunca demasiado eficaz en un medicamento antitumoral que posiblemente no está totalmente perfeccionado pero tiene futuro.

Es admirable el ingenio de estos investigadores que siguen y siguen y van perfeccionando los beneficios de esta terapia.

Mi charla con mi amigo Miguel ya muy lesionado y con su reservorio en la espalda fueron para mí gratificantes no por el efecto médico sino por la dignidad con que soportaba sus penurias.

Nuestros tiempos que están llenos de maldades, están sin embargo conduciéndonos a un desarrollo de terapia muy eficaces sobre todo contra los malditos tumores que tanto daño nos hacen y esto se debe a la tenacidad de los investigadores que le han cogido el truco a la inmunidad.

Nacho Aguiló, Eduardo Moreo, Ana Belén Gómez, Carlos Martín, Ana Picó y Santiago Uranga, de la Universidad de Zaragoza.

Sonia Moreno. Madrid Lun, 04/07/2022 – 08:00

 

ATENCIÓN DEL CÁNCER: AMPLIAR EL ALCANCE DE LA INNOVACIÓN

ATENCIÓN DEL CÁNCER: AMPLIAR EL ALCANCE DE LA INNOVACIÓN

THE LANCET EDITORIAL| VOLUMEN 399, NÚMERO 10344, P2325, 25 DE JUNIO DE 2022

Organizar los recursos y homogeneizarlos.

Me gusta de este artículo que da tanta importancia a la investigación contra el cáncer, como a las normas sociales para que llegue su bondad a todo el que la necesita.

El precio que tiene el CART-T, no es sostenible, vale una fortuna un tratamiento, pero su eficacia es evidente. Pero aumento previsto del Cancer en relativamente poco tiempo, obliga a normas, caritativas y honradas.

Hace que este disttibuir, sea tan importante como descubrir.

Los ineteres, de las farmacuticas y de las distribuidoras, y la reducción de los costes, para la seguridad social y para el enfermo, deben estar en la misma línea, y no lo hacen y el desequilibrio en el beneficio de las técnicas novedosas, solo llega países ricos, aunque el cancer y de manera creciente, lo sufren también los pobres.

Este desnivel es insostenible y mas lo es políticamente .

La innovación social y organización deben ir paralelos. Las diferencias en estos tiempos se soportan mal.

La American Society of Clinical Oncology (Sociedad Estadounidense de Oncología Clínica)

Fundada en 1964, la American Society of Clinical Oncology, Inc. (ASCO) está comprometida a lograr un mundo de diferencia en la atención del cáncer. Como la organización líder en el mundo de su tipo, la American Society of Clinical Oncology representa a más de 45,000 profesionales de oncología que atienden a personas que viven con cáncer. A través de la investigación, la educación y la promoción de la atención del paciente de la más alta calidad, ASCO trabaja para vencer el cáncer y crear un mundo
en el que el cáncer se prevenga o se cure, y donde cada sobreviviente esté sano.

ASCO amplía su misión a través de Cancer.Net y Conquer Cancer®, una Fundación de ASCO (Fundación para Vencer el Cáncer). Cancer.Net (www.cancer.net) ofrece la experiencia y los recursos de ASCO a las personas que viven con cáncer y a quienes las cuidan y se preocupan por ellas. Tanto la información como el contenido de Cancer.Net han sido desarrollados y aprobados por miembros de ASCO, lo que convierte a este sitio en un recurso actualizado y confiable en cuanto a información sobre el cáncer.

Conquer Cancer (www.conquer.org) financia la investigación de cada faceta del cáncer para beneficiar a todos los pacientes, en todos lados. Conquer Cancer ayuda a que la ciencia sea un alivio para los pacientes de todo el mundo al respaldar la investigación y educación de vanguardia en un espectro completo del cáncer.

Ojo con las diferencias sociales que conducen a las guerras entre otras maldades.

Describo el discurso de apertura en la reunión de la Sociedad Estadounidense de Oncología Clínica (ASCO) de 2022 a principios de junio fue recibido con gran entusiasmo. André Ilbawi, Oficial de Control del Cáncer de la OMS, anunció la primera asociación entre la ASCO y la OMS que, dice, “cataliza una innovación significativa para abordar las desigualdades persistentes, a nivel local y mundial, en la atención del cáncer”. El principio de la colaboración es incentivar las «innovaciones sociales y organizacionales» en lugar del desarrollo de nuevos medicamentos o diagnósticos, particularmente en países de bajos y medianos ingresos. ¿Qué significa esto exactamente?

Las definiciones de innovación social y organizacional varían, pero la OMS y la ASCO se están concentrando en estrategias arraigadas en la comunidad que aumentan la satisfacción del paciente, reducen las desigualdades y mejoran la calidad del tratamiento. En oncología, la innovación social a menudo ha significado nuevas formas de defensa, desestigmatización, empoderamiento de grupos de pacientes y educación pública: como aprovechar las voces de los pacientes para influir en la concienciación, la atención al paciente y la detección del cáncer de mama. O la introducción de programas de vacunación en las escuelas para aumentar la cobertura de vacunación contra el VPH. La innovación organizacional podría implicar poner a los hospitales y proveedores a cargo de los programas locales contra el cáncer (ellos sabrán mejor qué funciona localmente) en lugar del liderazgo nacional, u optimizar el uso de la fuerza laboral (entrenando a los cirujanos para administrar quimioterapia básica de bajo riesgo o enfermeras para administrar Cuidados paliativos). El punto es que, aunque los nuevos medicamentos, diagnósticos y tecnologías son importantes, no son lo que la mayoría de los pacientes con cáncer realmente necesitan. En cambio, las innovaciones más requeridas están a nivel comunitario, encontrando nuevas formas de poner en práctica lo que ya se sabe que funciona y permitiendo el acceso a intervenciones efectivas que tienen el beneficio más significativo para los pacientes.

Este principio está bien establecido. Hay programas de investigación para la ciencia de la implementación y conferencias dedicadas a la investigación de sistemas de salud. El Programa Especial de Investigación y Capacitación en Enfermedades Tropicales de UNICEF/PNUD/Banco Mundial/OMS ha defendido las intervenciones de salud basadas en la comunidad durante décadas. Por ejemplo, en el caso del VIH, el desarrollo de nuevos antirretrovirales eficaces se combinó con medios innovadores y pragmáticos de detección, suministro de tratamiento y prevención utilizando enfoques comunitarios y de salud pública. El número de nuevas infecciones por el VIH entre 2000 y 2014 se redujo en un 41 %.

A pesar del claro valor de los sistemas de salud centrados en las personas, la investigación oncológica, como en la mayoría de los campos de la medicina, está dominada por ensayos clínicos de nuevos medicamentos y tecnologías. Las prioridades de investigación están sesgadas por los intereses de las compañías farmacéuticas y las organizaciones de financiación de la investigación favorecen los ensayos de medicamentos. Los grandes proyectos de financiación orientados al desarrollo de la ciencia de alta tecnología tienen sin duda buenas intenciones: el programa Cancer Moonshot recientemente relanzado, Cancer Research UK’s Grand Challenges, Canadian Institutes of Health Research’s Grand Challenges y EU Mission on Cancer. Sin embargo, sin una inversión complementaria en investigación sobre la implementación, es probable que el resultado sea una atención del cáncer cada vez más inequitativa a nivel mundial, centrada en avances incrementales a los que solo puede acceder una pequeña minoría de pacientes. En 2018, Bishal Gyawali y sus colegas pidieron un «primer plano del cáncer», con inversiones realizadas para optimizar las infraestructuras, los sistemas de salud y las intervenciones que ya han demostrado que funcionan: «globalizarse antes de ir a la luna». Esas inversiones aún no se han hecho.

Se prevé que la carga del cáncer en los países de ingresos bajos y medianos se duplique en las próximas dos décadas (de 12 millones de casos por año a 20 millones de casos por año para 2040, lo que representa más del 75 % de los casos de cáncer en el mundo). El mundo no va por buen camino para alcanzar los objetivos de cobertura sanitaria universal. ¿Cómo puede la oncología servir mejor a muchos y no a unos pocos? Una agenda de investigación impulsada por las prioridades de la industria debe cambiar. Los programas existentes para fortalecer la atención global del cáncer, como ASCO, ESMO, el Banco Mundial, la OMS y organizaciones no gubernamentales, se han fragmentado. Deben ampliarse y coordinarse mejor, con una gama más amplia de colaboradores, desde los gobiernos hasta la sociedad civil. El nuevo programa OMS-ASCO es prometedor: debe juzgarse por sus resultados.

Pero el problema que busca abordar es de larga data: los medicamentos y las tecnologías son importantes, pero harán poca diferencia en un sistema de salud insensible a las necesidades de las personas y las comunidades. El equilibrio entre los dos ha estado desequilibrado durante mucho tiempo en oncología. Es hora de un reinicio radical en la investigación del cáncer,

Pero da alegría que la investigación se preocupa además del beneficio del que sufre.

Organizar los recursos y homogeneizar los hallazgos

 

 

DOSTARLIMAB, EN CANCERES SÓLIDOS CON DMMR  DE COLON Y ENDOMETRIO

DOSTARLIMAB, EN CANCERES SÓLIDOS CON DMMR  DE COLON Y ENDOMETRIO

La eficacia de la medicación DOSTARLIMAB,, se ha mostrado muy eficaz en canceres de colon y menos en los de endometrio.

Ambos  tumores sólidos con dMMR parecen responder bien a este tipo de tratamiento.

La dMMR es el sello distintivo del síndrome de Lynch (antes conocido como cáncer colorrectal hereditario sin poliposis), un trastorno de cáncer hereditario que aumenta el riesgo de cáncer colorrectal y de otros tipos de cáncer de por vida en los pacientes y tiene implicaciones para los parientes de estos.

Los descubrimientos del estudio también confirmaron la importancia de detectar dMMR en pacientes con cáncer rectal. Un cáncer hereditario que aumenta el riesgo de cáncer colorrectal y de otros tipos de cáncer de por vida en los pacientes y tiene implicaciones para los parientes de estos. El síndrome de Lynch es causado por defectos en los genes de reparación de desajustes, incluidos MLH1, MSH2, MSH6 y PMS2. La mayoría de los pacientes del estudio tenían el síndrome de Lynch, y la mayoría de los pacientes con ese síndrome además tenían mutaciones de línea germinal patogénicas en los genes MSH2 o MSH6. Los defectos en los genes MSH2 y MSH6 pueden predisponer a los pacientes al cáncer colorrectal, pero también se asocian con otros cánceres. Cerca de un quinto de los pacientes con cáncer rectal con dMMR del estudio tenían antecedentes de al menos un cáncer no colorrectal antes de su diagnóstico, y otro quinto desarrolló al menos un cáncer no colorrectal durante el período de seguimiento.

“Esos pacientes necesitan vigilancia de por vida de otros cánceres en otros órganos

Dada la gravedad de este síndrome, la aparición de una medicación eficaz es enormemente gratificante. Microsatellite Instability – Defective DNA Mismatch Repair

Luis A. Diaz, responsable del estudio, publicó los resultados en la revista New England Journal of Medicine, dijo que no conocía ningún otro estudio en el que un tratamiento lograra eliminar por completo un cáncer en todos los pacientes. “Creo que es la primera vez que esto sucede en la historia del cáncer”, dijo Díaz en “The New York Times”. Alan P. Venook, especialista en cáncer colorrectal de la Universidad de California en San Francisco, calificó el resultado de “inaudito”.

Por otra parte y de manera menos afortunada, el Dostarlimab para ha sido empleado en el CÁNCER DE ENDOMETRIO con deficiencia en la reparación de errores de emparejamiento recurrente o avanzado

Un ensayo clínico de fase 1 no aleatorizado

Ana Oaknin, MD, PhD1; Anna V. Tinker, MD2; Lucy Gilbert, MD3; et alVanessa Samouëlian, MD4; Cara Mathews, MD5; Jubileo Brown, MD6; María-Pilar Barretina-Ginesta, MD7,8; Víctor Moreno, MD9; Adriano Gravina, MD10; Cirilo Abdeddaim, MD11; Susana Banerjee, MD12; Wei Guo, PhD13; Hadi Danaee, ScD14; Ellie Im, MD15; Renaud Sabatier, MD16

Autor Afiliaciones Información del artículo

JAMA Oncol. 2020;6(11):1766-1772. doi:10.1001/jamaoncol.2020.4515

Hallazgos En este ensayo clínico de fase 1 no aleatorizado, la tasa de respuesta objetiva confirmada fue del 42 %; El 13 % de los pacientes tuvo una respuesta completa confirmada y el 30 % de los pacientes tuvo una respuesta parcial confirmada. La anemia (3 %), la colitis (2 %) y la diarrea (2 %) fueron los eventos adversos relacionados con el tratamiento de grado 3 o superior más comunes.

Lo que significa que Dostarlimab se asoció con una actividad antitumoral clínicamente significativa y duradera con un perfil de seguridad aceptable para pacientes con cánceres de endometrio con reparación deficiente de errores de emparejamiento que han progresado después de una quimioterapia previa basada en platino.

Los mecanismos de reparación de mutaciones de desajustes deficientes pueden sensibilizar a los cánceres de endometrio a las terapias contra la muerte programada 1 (PD-1). Dostarlimab (TSR-042) es un anticuerpo anti-PD-1 en investigación que se une con alta afinidad al receptor PD-1.

Diseño, entorno y participantes Este estudio multicéntrico, abierto, de un solo grupo y en curso comenzó la parte 1 el 7 de marzo de 2016 y comenzó a inscribir a pacientes con cáncer de endometrio con reparación de mutaciones deficientes el 8 de mayo de 2017. La mediana de seguimiento fue 11,2 meses (rango, 0,03 [en curso] a 22,11 [en curso] meses; según evaluaciones radiológicas). El análisis estadístico se realizó del 8 de julio al 9 de agosto de 2019.

Los pacientes recibieron 500 mg de dostarlimab por vía intravenosa cada 3 semanas durante 4 dosis, luego 1000 mg cada 6 semanas hasta la progresión de la enfermedad, la interrupción del tratamiento o el retiro.

Principales resultados y medidas El criterio principal de valoración fue la tasa de respuesta objetiva y la duración de la respuesta mediante una revisión central independiente ciega utilizando los Criterios de evaluación de respuesta en tumores sólidos, versión 1.1.

Resultados A partir del corte de datos, 104 mujeres (mediana de edad, 64,0 años [rango, 38-80 años]) con cánceres de endometrio con reparación de mutación deficiente de coincidencia fueron inscritas y tratadas con dostarlimab. De estos, 71 tenían enfermedad medible al inicio y a los 6 meses o más de seguimiento y se incluyeron en el análisis. Hubo una respuesta confirmada en 30 pacientes (tasa de respuesta objetiva, 42,3 %; IC del 95 %, 30,6 %-54,6 %); 9 pacientes (12,7 %) tuvieron una respuesta completa confirmada y 21 pacientes (29,6 %) tuvieron una respuesta parcial confirmada. Las respuestas fueron duraderas; no se alcanzó la mediana de duración de la respuesta (la mediana de seguimiento fue de 11,2 meses). La probabilidad estimada de mantener una respuesta fue del 96,4% a los 6 meses y del 76,8% a los 12 meses. La anemia (3 de 104 [2,9 %]), la colitis (2 de 104 [1,9 %]) y la diarrea (2 de 104 [1,9 %]) fueron los eventos adversos relacionados con el tratamiento de grado 3 o superior más comunes.

En este ensayo no aleatorizado, dostarlimab se asoció con una actividad antitumoral clínicamente significativa y duradera con un perfil de seguridad aceptable para pacientes con cánceres de endometrio con reparación de mutaciones deficientes después de quimioterapia previa basada en platino.

Aproximadamente 15000 pacientes en los Estados Unidos y 11000 pacientes en la Unión Europea son diagnosticadas anualmente con cáncer de endometrio (EC) avanzado o recurrente.1 La EC en etapa temprana puede tratarse con éxito mediante cirugía sola o cirugía con radioterapia o quimioterapia adyuvante ( generalmente quimioterapia doble basada en platino). El pronóstico para los pacientes con un diagnóstico de EC avanzada o recurrente es malo y, hasta donde sabemos, no existen pautas aceptadas basadas en consenso para el estándar de atención después de que la enfermedad progresa durante o después del tratamiento con un régimen que contiene platino. Los pacientes en este entorno generalmente reciben atención de rescate con quimioterapia de agente único o terapia hormonal, con actividad clínica limitada; las tasas de respuesta oscilan entre el 7 % y el 14 %, y la mediana de supervivencia general (SG) es inferior a 1 año.2-6

El cáncer de endometrio es un tipo de tumor asociado con altas tasas de inestabilidad de microsatélites-condición alta y reparación de desajustes de ADN-deficiencia (MSI-H/dMMR). Un informe de 2017 de Le et al7 evaluó 12019 muestras de tumores, que representan 32 tipos de tumores distintos para MSI-H/dMMR, e identificó EC como uno de los c

EL DOSTARLIMAB, ha logrado la remisión del cáncer de recto en un ensayo

El medicamento ha obtenido buena respuesta en 12 pacientes como parte de un ensayo clínico de fase II.

«El nuevo fármaco contra el cáncer de recto es muy prometedor, pero solo es extrapolable al 5% de los pacientes”.

Células de cáncer de colon

Células de cáncer de colon@[luismmolina de Getty Images] via canva.com

El dostarlimab ha sido noticia recientemente después de que se publicasen los resultados de un ensayo clínico de fase II para su uso en el cáncer de colon. En dicha investigación, publicada en el medio The New England Journal of Medicine, el fármaco logró la remisión completa de los tumores en todos los participantes.

El objetivo: cáncer con reparación de desajuste deficiente

El medicamento en cuestión pertenece a una rama relativamente joven de las terapias contra el cáncer, pero que en los últimos años ha crecido enormemente: la inmunoterapia. Concretamente, el dostarlimab es un anticuerpo monoclonal anti-PD-1.

Para entender lo que esto significa, debemos repasar algunos de los mecanismos causantes del cáncer.

Normalmente, y tal como indica la Sociedad Americana del Cáncer, es normal que por el envejecimiento o por otros motivos (como el contacto con determinadas sustancias) las células sufran daño en el ADN. Nuestro organismo cuenta con varios sistemas para acabar con estas células y evitar que, al reproducirse, el daño se propague; por desgracia, estos métodos a veces fallan, y las células dañadas comienzan a reproducirse sin control.

Células afectadas por cáncer de colon.

Un fármaco logra remitir por completo el cáncer en todos los pacientes de un estudio

Más en concreto, existe cierto tipo de cánceres (como muchos colorrectales, señala el estadounidense Instituto Nacional del Cáncer) en los que ciertos genes implicados en la corrección de fallos cuando la célula copia fragmentos de ADN (proceso necesario para ‘enviar’ la información de ese fragmento a los ribosomas, que después expresan el gen en forma de proteína) no funcionan correctamente. Esto se llama reparación de desajuste deficiente (dMMR, por sus siglas en inglés), y es el tipo de cáncer frente al que, al menos por ahora, el dostarlimab parece excepcionalmente eficaz.

El mecanismo de acción: inhibir los ‘puestos de control’

Como decíamos, las células cancerosas son uno de los elementos nocivos que nuestro sistema inmune debería detectar y eliminar. En condiciones normales, para hacer esto se sirve, entre otras cosas, de lo que se conoce como ‘puestos de control’: una serie de proteínas presentes en las células inmunes (a esta clase pertenece la proteína PD-1) que, al entrar en contacto con una proteína complementaria (en el caso de la PD-1, la proteína PD-L1) presente en otras células del cuerpo, funcionan como ‘interruptores’ que evitan una respuesta inmune.

Thank you for watching

Con todo, algunos tumores (que, no olvidemos, provienen de células del propio organismo que han sido dañadas) aún expresan la proteína PD-L1 (incluso, en cantidades mayores a lo normal, lo que efectivamente los protege de la acción del sistema inmune).

Un nuevo tratamiento contra el cáncer de pulmón multiplica por seis la erradicación de los tumores

En este principio se basan ciertas inmunoterapias contra el cáncer, según desarrolla la Sociedad Americana del Cáncer, que buscan interferir en este sistema para ‘guiar’ al sistema inmune a atacar esas células que no reconoce como enemigas. Para lograr tal cosa, se emplean anticuerpos (una molécula que se une a otra de una sustancia extraña, llamada antígeno) monoclonales (siempre idénticos, ya que son producidos por un único tipo de célula inmune) producidos artificialmente para que se unan a una de las dos proteínas (la PD-1 o la PD-L1) de forma que el propio sistema inmune la reconozca como antígeno y la ataque, inhibiendo la función de los puestos de control.

Por este complejo método, se elimina la cobertura de las células tumorales frente al sistema inmune, que ahora sí que las ataca y acaba con ellas.

Muchos tumores sólidos con dMMR parecen responder bien a este tipo de tratamiento.

El resultado: muy prometedor, pero aún no definitivo

Recapitulando, el dostarlimab es uno de los medicamentos empleados en este tipo de inmunoterapia, indicado hasta ahora en tumores de endometrio con dMMR. La novedad del ensayo clínico citado es que se estaba probando la eficacia y seguridad de su uso en pacientes con adenocarcinoma de colon con dMMR de estadios II y III, ya que este tipo de tumores parece ser sensible a la inmunoterapia

anti-PD-1.

Los resultados han sido tremendamente positivos. Tanto que han sorprendido a los propios autores del trabajo: originalmente, pensaban administrar quimioterapia a aquellos pacientes que no lograsen la remisión completa tras la administración de dostarlimab, a fin de estudiar la eficacia de la terapia coadyuvante, pero esto no ha hecho falta debido a que la remisión se ha dado en el 100% de los 12 pacientes.

La noticia es por ello muy esperanzadora.

Autores del trabajo

Luis A. Diaz,  New England Journal of Medicine

Ana Oaknin, MD, PhD1; Anna V. Tinker, MD2; Lucy Gilbert, MD3; et alVanessa Samouëlian, MD4; Cara Mathews, MD5; Jubileo Brown, MD6; María-Pilar Barretina-Ginesta, MD7,8; Víctor Moreno, MD9; Adriano Gravina, MD10; Cirilo Abdeddaim, MD11; Susana Banerjee, MD12; Wei Guo, PhD13; Hadi Danaee, ScD14; Ellie Im, MD15; Renaud Sabatier, MD16

Autor Afiliaciones Información del artículo

JAMA Oncol. 2020;6(11):1766-1772. doi:10.1001/jamaoncol.2020.4515

D

LAS CELULAS CANCEROSAS DUERMEN A LAS INMUNES

 

El beso letal entre las células del cáncer y las defensas del cuerpo humano

Un equipo de científicos descubre cómo algunos tumores logran dormir a los feroces soldados del sistema inmune

Una célula NK, señalada por una flecha, se vuelve verde tras robar un fragmento de la membrana de una célula cancerosa, también verde. Una célula NK, señalada por una flecha, se vuelve verde tras robar un fragmento de la membrana de una célula cancerosa, también verde.HASIM ET AL.

Un grupo de investigadores ha iluminado un fenómeno desconcertante. Cuando una célula humana se descontrola y empieza a multiplicarse a lo loco, amenazando con iniciar un cáncer, esas hijas malignas se enfrentan a las siempre atentas defensas del organismo. Algunos glóbulos blancos, como las células NK (siglas de Natural Killers, “asesinas naturales” en inglés), son capaces de reconocer y exterminar a las células cancerosas. Los científicos, del Hospital de Ottawa (Canadá), explican que, sin embargo, en algunos tumores de la sangre, las feroces NK quedan adormecidas tras dar “una especie de beso” a las células del cáncer.

 

« Entradas anteriores